OSDN Git Service

Initial commit. master
authorAkira KINJO <arkinjo@users.sourceforge.jp>
Wed, 22 Feb 2012 02:49:42 +0000 (11:49 +0900)
committerAkira KINJO <arkinjo@users.sourceforge.jp>
Wed, 22 Feb 2012 02:49:42 +0000 (11:49 +0900)
304 files changed:
00README [new file with mode: 0644]
WMATS [new file with mode: 0644]
WMATS2000 [new file with mode: 0644]
WMATS5000 [new file with mode: 0644]
WMATS_LIN [new file with mode: 0644]
WMAT_ENS [new file with mode: 0644]
bin/lpredm [new file with mode: 0755]
bin/run_crn.sh [new file with mode: 0755]
bin/xpredm2000 [new file with mode: 0755]
bin/xpredm5000 [new file with mode: 0755]
make.sh [new file with mode: 0755]
sample/3chyA.fa [new file with mode: 0644]
sample/3chyA.out [new file with mode: 0644]
sample/d1a6m__.out [new file with mode: 0644]
sample/d1a6m__.prof [new file with mode: 0644]
sample/d1ifra_.out [new file with mode: 0644]
sample/d1ifra_.prof [new file with mode: 0644]
sample/d3nul__.out [new file with mode: 0644]
sample/d3nul__.prof [new file with mode: 0644]
sample/d8abp__.out [new file with mode: 0644]
sample/d8abp__.prof [new file with mode: 0644]
src/ChangeLog [new file with mode: 0644]
src/Makefile [new file with mode: 0644]
src/blast.c [new file with mode: 0644]
src/blast.h [new file with mode: 0644]
src/chkaccu.c [new file with mode: 0644]
src/chkaccu.h [new file with mode: 0644]
src/crndump.c [new file with mode: 0644]
src/eprintf.c [new file with mode: 0644]
src/eprintf.h [new file with mode: 0644]
src/lpredm.c [new file with mode: 0644]
src/secdp.c [new file with mode: 0644]
src/sov.c [new file with mode: 0644]
src/sov.h [new file with mode: 0644]
src/xesn.c [new file with mode: 0644]
src/xesn.h [new file with mode: 0644]
src/xpredm.c [new file with mode: 0644]
src/xpredm.h [new file with mode: 0644]
src/xpredmsub.c [new file with mode: 0644]
w2000/Mat/win2000_21.0.01a.mat [new file with mode: 0644]
w2000/Mat/win2000_21.0.01b.mat [new file with mode: 0644]
w2000/Mat/win2000_21.0.01c.mat [new file with mode: 0644]
w2000/Mat/win2000_21.0.01d.mat [new file with mode: 0644]
w2000/Mat/win2000_21.0.01e.mat [new file with mode: 0644]
w2000/Mat/win2000_21.0.01f.mat [new file with mode: 0644]
w2000/Mat/win2000_21.0.01g.mat [new file with mode: 0644]
w2000/Mat/win2000_21.0.01h.mat [new file with mode: 0644]
w2000/Mat/win2000_21.0.01i.mat [new file with mode: 0644]
w2000/Mat/win2000_21.0.01j.mat [new file with mode: 0644]
w2000/Mat/win2000_21.0.01k.mat [new file with mode: 0644]
w2000/Mat/win2000_21.0.01l.mat [new file with mode: 0644]
w2000/Mat/win2000_21.0.01m.mat [new file with mode: 0644]
w2000/Mat/win2000_21.0.01n.mat [new file with mode: 0644]
w2000/Mat/win2000_21.0.01o.mat [new file with mode: 0644]
w2000/Mat/win2000_21.0.01p.mat [new file with mode: 0644]
w2000/Mat/win2000_21.0.01q.mat [new file with mode: 0644]
w2000/Mat/win2000_21.0.01r.mat [new file with mode: 0644]
w2000/Mat/win2000_21.0.01s.mat [new file with mode: 0644]
w2000/Mat/win2000_21.0.01t.mat [new file with mode: 0644]
w2000/Mat/wmat2000_20_1.0a.mat [new file with mode: 0644]
w2000/Mat/wmat2000_20_1.0b.mat [new file with mode: 0644]
w2000/Mat/wmat2000_20_1.0c.mat [new file with mode: 0644]
w2000/Mat/wmat2000_20_1.0d.mat [new file with mode: 0644]
w2000/Mat/wmat2000_20_1.0e.mat [new file with mode: 0644]
w2000/Mat/wmat2000_20_1.0f.mat [new file with mode: 0644]
w2000/Mat/wmat2000_20_1.0g.mat [new file with mode: 0644]
w2000/Mat/wmat2000_20_1.0h.mat [new file with mode: 0644]
w2000/Mat/wmat2000_20_1.0i.mat [new file with mode: 0644]
w2000/Mat/wmat2000_20_1.0j.mat [new file with mode: 0644]
w2000/Mat/wmat2000_20_1.0k.mat [new file with mode: 0644]
w2000/Mat/wmat2000_20_1.0l.mat [new file with mode: 0644]
w2000/Mat/wmat2000_20_1.0m.mat [new file with mode: 0644]
w2000/Mat/wmat2000_20_1.0n.mat [new file with mode: 0644]
w2000/Mat/wmat2000_20_1.0o.mat [new file with mode: 0644]
w2000/Mat/wmat2000_20_1.0p.mat [new file with mode: 0644]
w2000/Mat/wmat2000_20_1.0q.mat [new file with mode: 0644]
w2000/Mat/wmat2000_20_1.0r.mat [new file with mode: 0644]
w2000/Mat/wmat2000_20_1.0s.mat [new file with mode: 0644]
w2000/Mat/wmat2000_20_1.0t.mat [new file with mode: 0644]
w2000/WMATS [new file with mode: 0644]
w2000/WMAT_ENS [new file with mode: 0644]
w2000/mkwmats.sh [new file with mode: 0755]
w2000/w_cn/xwoutalla.mat [new file with mode: 0644]
w2000/w_cn/xwoutallb.mat [new file with mode: 0644]
w2000/w_cn/xwoutallc.mat [new file with mode: 0644]
w2000/w_cn/xwoutalld.mat [new file with mode: 0644]
w2000/w_cn/xwoutalle.mat [new file with mode: 0644]
w2000/w_cn/xwoutallf.mat [new file with mode: 0644]
w2000/w_cn/xwoutallg.mat [new file with mode: 0644]
w2000/w_cn/xwoutallh.mat [new file with mode: 0644]
w2000/w_cn/xwoutalli.mat [new file with mode: 0644]
w2000/w_cn/xwoutallj.mat [new file with mode: 0644]
w2000/w_cn/xwoutallk.mat [new file with mode: 0644]
w2000/w_cn/xwoutalll.mat [new file with mode: 0644]
w2000/w_cn/xwoutallm.mat [new file with mode: 0644]
w2000/w_cn/xwoutalln.mat [new file with mode: 0644]
w2000/w_cn/xwoutallo.mat [new file with mode: 0644]
w2000/w_cn/xwoutallp.mat [new file with mode: 0644]
w2000/w_cn/xwoutallq.mat [new file with mode: 0644]
w2000/w_cn/xwoutallr.mat [new file with mode: 0644]
w2000/w_cn/xwoutalls.mat [new file with mode: 0644]
w2000/w_cn/xwoutallt.mat [new file with mode: 0644]
w2000/w_rwco/xwoutalla.mat [new file with mode: 0644]
w2000/w_rwco/xwoutallb.mat [new file with mode: 0644]
w2000/w_rwco/xwoutallc.mat [new file with mode: 0644]
w2000/w_rwco/xwoutalld.mat [new file with mode: 0644]
w2000/w_rwco/xwoutalle.mat [new file with mode: 0644]
w2000/w_rwco/xwoutallf.mat [new file with mode: 0644]
w2000/w_rwco/xwoutallg.mat [new file with mode: 0644]
w2000/w_rwco/xwoutallh.mat [new file with mode: 0644]
w2000/w_rwco/xwoutalli.mat [new file with mode: 0644]
w2000/w_rwco/xwoutallj.mat [new file with mode: 0644]
w2000/w_rwco/xwoutallk.mat [new file with mode: 0644]
w2000/w_rwco/xwoutalll.mat [new file with mode: 0644]
w2000/w_rwco/xwoutallm.mat [new file with mode: 0644]
w2000/w_rwco/xwoutalln.mat [new file with mode: 0644]
w2000/w_rwco/xwoutallo.mat [new file with mode: 0644]
w2000/w_rwco/xwoutallp.mat [new file with mode: 0644]
w2000/w_rwco/xwoutallq.mat [new file with mode: 0644]
w2000/w_rwco/xwoutallr.mat [new file with mode: 0644]
w2000/w_rwco/xwoutalls.mat [new file with mode: 0644]
w2000/w_rwco/xwoutallt.mat [new file with mode: 0644]
w2000/w_ss/xwoutalla.mat [new file with mode: 0644]
w2000/w_ss/xwoutallb.mat [new file with mode: 0644]
w2000/w_ss/xwoutallc.mat [new file with mode: 0644]
w2000/w_ss/xwoutalld.mat [new file with mode: 0644]
w2000/w_ss/xwoutalle.mat [new file with mode: 0644]
w2000/w_ss/xwoutallf.mat [new file with mode: 0644]
w2000/w_ss/xwoutallg.mat [new file with mode: 0644]
w2000/w_ss/xwoutallh.mat [new file with mode: 0644]
w2000/w_ss/xwoutalli.mat [new file with mode: 0644]
w2000/w_ss/xwoutallj.mat [new file with mode: 0644]
w2000/w_ss/xwoutallk.mat [new file with mode: 0644]
w2000/w_ss/xwoutalll.mat [new file with mode: 0644]
w2000/w_ss/xwoutallm.mat [new file with mode: 0644]
w2000/w_ss/xwoutalln.mat [new file with mode: 0644]
w2000/w_ss/xwoutallo.mat [new file with mode: 0644]
w2000/w_ss/xwoutallp.mat [new file with mode: 0644]
w2000/w_ss/xwoutallq.mat [new file with mode: 0644]
w2000/w_ss/xwoutallr.mat [new file with mode: 0644]
w2000/w_ss/xwoutalls.mat [new file with mode: 0644]
w2000/w_ss/xwoutallt.mat [new file with mode: 0644]
w5000/Mat/win5000_21.0.01a.mat [new file with mode: 0644]
w5000/Mat/win5000_21.0.01b.mat [new file with mode: 0644]
w5000/Mat/win5000_21.0.01c.mat [new file with mode: 0644]
w5000/Mat/win5000_21.0.01d.mat [new file with mode: 0644]
w5000/Mat/win5000_21.0.01e.mat [new file with mode: 0644]
w5000/Mat/win5000_21.0.01f.mat [new file with mode: 0644]
w5000/Mat/win5000_21.0.01g.mat [new file with mode: 0644]
w5000/Mat/win5000_21.0.01h.mat [new file with mode: 0644]
w5000/Mat/win5000_21.0.01i.mat [new file with mode: 0644]
w5000/Mat/win5000_21.0.01j.mat [new file with mode: 0644]
w5000/Mat/win5000_21.0.01k.mat [new file with mode: 0644]
w5000/Mat/win5000_21.0.01l.mat [new file with mode: 0644]
w5000/Mat/win5000_21.0.01m.mat [new file with mode: 0644]
w5000/Mat/win5000_21.0.01n.mat [new file with mode: 0644]
w5000/Mat/win5000_21.0.01o.mat [new file with mode: 0644]
w5000/Mat/win5000_21.0.01p.mat [new file with mode: 0644]
w5000/Mat/win5000_21.0.01q.mat [new file with mode: 0644]
w5000/Mat/win5000_21.0.01r.mat [new file with mode: 0644]
w5000/Mat/win5000_21.0.01s.mat [new file with mode: 0644]
w5000/Mat/win5000_21.0.01t.mat [new file with mode: 0644]
w5000/Mat/wmat5000_50_1.0a.mat [new file with mode: 0644]
w5000/Mat/wmat5000_50_1.0b.mat [new file with mode: 0644]
w5000/Mat/wmat5000_50_1.0c.mat [new file with mode: 0644]
w5000/Mat/wmat5000_50_1.0d.mat [new file with mode: 0644]
w5000/Mat/wmat5000_50_1.0e.mat [new file with mode: 0644]
w5000/Mat/wmat5000_50_1.0f.mat [new file with mode: 0644]
w5000/Mat/wmat5000_50_1.0g.mat [new file with mode: 0644]
w5000/Mat/wmat5000_50_1.0h.mat [new file with mode: 0644]
w5000/Mat/wmat5000_50_1.0i.mat [new file with mode: 0644]
w5000/Mat/wmat5000_50_1.0j.mat [new file with mode: 0644]
w5000/Mat/wmat5000_50_1.0k.mat [new file with mode: 0644]
w5000/Mat/wmat5000_50_1.0l.mat [new file with mode: 0644]
w5000/Mat/wmat5000_50_1.0m.mat [new file with mode: 0644]
w5000/Mat/wmat5000_50_1.0n.mat [new file with mode: 0644]
w5000/Mat/wmat5000_50_1.0o.mat [new file with mode: 0644]
w5000/Mat/wmat5000_50_1.0p.mat [new file with mode: 0644]
w5000/Mat/wmat5000_50_1.0q.mat [new file with mode: 0644]
w5000/Mat/wmat5000_50_1.0r.mat [new file with mode: 0644]
w5000/Mat/wmat5000_50_1.0s.mat [new file with mode: 0644]
w5000/Mat/wmat5000_50_1.0t.mat [new file with mode: 0644]
w5000/WMATS [new file with mode: 0644]
w5000/WMAT_ENS [new file with mode: 0644]
w5000/w_cn/xwoutalla.mat [new file with mode: 0644]
w5000/w_cn/xwoutallb.mat [new file with mode: 0644]
w5000/w_cn/xwoutallc.mat [new file with mode: 0644]
w5000/w_cn/xwoutalld.mat [new file with mode: 0644]
w5000/w_cn/xwoutalle.mat [new file with mode: 0644]
w5000/w_cn/xwoutallf.mat [new file with mode: 0644]
w5000/w_cn/xwoutallg.mat [new file with mode: 0644]
w5000/w_cn/xwoutallh.mat [new file with mode: 0644]
w5000/w_cn/xwoutalli.mat [new file with mode: 0644]
w5000/w_cn/xwoutallj.mat [new file with mode: 0644]
w5000/w_cn/xwoutallk.mat [new file with mode: 0644]
w5000/w_cn/xwoutalll.mat [new file with mode: 0644]
w5000/w_cn/xwoutallm.mat [new file with mode: 0644]
w5000/w_cn/xwoutalln.mat [new file with mode: 0644]
w5000/w_cn/xwoutallo.mat [new file with mode: 0644]
w5000/w_cn/xwoutallp.mat [new file with mode: 0644]
w5000/w_cn/xwoutallq.mat [new file with mode: 0644]
w5000/w_cn/xwoutallr.mat [new file with mode: 0644]
w5000/w_cn/xwoutalls.mat [new file with mode: 0644]
w5000/w_cn/xwoutallt.mat [new file with mode: 0644]
w5000/w_rwco/xwoutalla.mat [new file with mode: 0644]
w5000/w_rwco/xwoutallb.mat [new file with mode: 0644]
w5000/w_rwco/xwoutallc.mat [new file with mode: 0644]
w5000/w_rwco/xwoutalld.mat [new file with mode: 0644]
w5000/w_rwco/xwoutalle.mat [new file with mode: 0644]
w5000/w_rwco/xwoutallf.mat [new file with mode: 0644]
w5000/w_rwco/xwoutallg.mat [new file with mode: 0644]
w5000/w_rwco/xwoutallh.mat [new file with mode: 0644]
w5000/w_rwco/xwoutalli.mat [new file with mode: 0644]
w5000/w_rwco/xwoutallj.mat [new file with mode: 0644]
w5000/w_rwco/xwoutallk.mat [new file with mode: 0644]
w5000/w_rwco/xwoutalll.mat [new file with mode: 0644]
w5000/w_rwco/xwoutallm.mat [new file with mode: 0644]
w5000/w_rwco/xwoutalln.mat [new file with mode: 0644]
w5000/w_rwco/xwoutallo.mat [new file with mode: 0644]
w5000/w_rwco/xwoutallp.mat [new file with mode: 0644]
w5000/w_rwco/xwoutallq.mat [new file with mode: 0644]
w5000/w_rwco/xwoutallr.mat [new file with mode: 0644]
w5000/w_rwco/xwoutalls.mat [new file with mode: 0644]
w5000/w_rwco/xwoutallt.mat [new file with mode: 0644]
w5000/w_ss/xwoutalla.mat [new file with mode: 0644]
w5000/w_ss/xwoutallb.mat [new file with mode: 0644]
w5000/w_ss/xwoutallc.mat [new file with mode: 0644]
w5000/w_ss/xwoutalld.mat [new file with mode: 0644]
w5000/w_ss/xwoutalle.mat [new file with mode: 0644]
w5000/w_ss/xwoutallf.mat [new file with mode: 0644]
w5000/w_ss/xwoutallg.mat [new file with mode: 0644]
w5000/w_ss/xwoutallh.mat [new file with mode: 0644]
w5000/w_ss/xwoutalli.mat [new file with mode: 0644]
w5000/w_ss/xwoutallj.mat [new file with mode: 0644]
w5000/w_ss/xwoutallk.mat [new file with mode: 0644]
w5000/w_ss/xwoutalll.mat [new file with mode: 0644]
w5000/w_ss/xwoutallm.mat [new file with mode: 0644]
w5000/w_ss/xwoutalln.mat [new file with mode: 0644]
w5000/w_ss/xwoutallo.mat [new file with mode: 0644]
w5000/w_ss/xwoutallp.mat [new file with mode: 0644]
w5000/w_ss/xwoutallq.mat [new file with mode: 0644]
w5000/w_ss/xwoutallr.mat [new file with mode: 0644]
w5000/w_ss/xwoutalls.mat [new file with mode: 0644]
w5000/w_ss/xwoutallt.mat [new file with mode: 0644]
wlin/w_1d/lwout00a.mat [new file with mode: 0644]
wlin/w_1d/lwout01a.mat [new file with mode: 0644]
wlin/w_1d/lwout02a.mat [new file with mode: 0644]
wlin/w_1d/lwout03a.mat [new file with mode: 0644]
wlin/w_1d/lwout04a.mat [new file with mode: 0644]
wlin/w_1d/lwout05a.mat [new file with mode: 0644]
wlin/w_1d/lwout06a.mat [new file with mode: 0644]
wlin/w_1d/lwout07a.mat [new file with mode: 0644]
wlin/w_1d/lwout08a.mat [new file with mode: 0644]
wlin/w_1d/lwout09a.mat [new file with mode: 0644]
wlin/w_1d/lwout10a.mat [new file with mode: 0644]
wlin/w_1d/lwout11a.mat [new file with mode: 0644]
wlin/w_1d/lwout12a.mat [new file with mode: 0644]
wlin/w_1d/lwout13a.mat [new file with mode: 0644]
wlin/w_1d/lwout14a.mat [new file with mode: 0644]
wlin/w_cn/lwout00a.mat [new file with mode: 0644]
wlin/w_cn/lwout01a.mat [new file with mode: 0644]
wlin/w_cn/lwout02a.mat [new file with mode: 0644]
wlin/w_cn/lwout03a.mat [new file with mode: 0644]
wlin/w_cn/lwout04a.mat [new file with mode: 0644]
wlin/w_cn/lwout05a.mat [new file with mode: 0644]
wlin/w_cn/lwout06a.mat [new file with mode: 0644]
wlin/w_cn/lwout07a.mat [new file with mode: 0644]
wlin/w_cn/lwout08a.mat [new file with mode: 0644]
wlin/w_cn/lwout09a.mat [new file with mode: 0644]
wlin/w_cn/lwout10a.mat [new file with mode: 0644]
wlin/w_cn/lwout11a.mat [new file with mode: 0644]
wlin/w_cn/lwout12a.mat [new file with mode: 0644]
wlin/w_cn/lwout13a.mat [new file with mode: 0644]
wlin/w_cn/lwout14a.mat [new file with mode: 0644]
wlin/w_rwco/lwout00a.mat [new file with mode: 0644]
wlin/w_rwco/lwout01a.mat [new file with mode: 0644]
wlin/w_rwco/lwout02a.mat [new file with mode: 0644]
wlin/w_rwco/lwout03a.mat [new file with mode: 0644]
wlin/w_rwco/lwout04a.mat [new file with mode: 0644]
wlin/w_rwco/lwout05a.mat [new file with mode: 0644]
wlin/w_rwco/lwout06a.mat [new file with mode: 0644]
wlin/w_rwco/lwout07a.mat [new file with mode: 0644]
wlin/w_rwco/lwout08a.mat [new file with mode: 0644]
wlin/w_rwco/lwout09a.mat [new file with mode: 0644]
wlin/w_rwco/lwout10a.mat [new file with mode: 0644]
wlin/w_rwco/lwout11a.mat [new file with mode: 0644]
wlin/w_rwco/lwout12a.mat [new file with mode: 0644]
wlin/w_rwco/lwout13a.mat [new file with mode: 0644]
wlin/w_rwco/lwout14a.mat [new file with mode: 0644]
wlin/w_ss/lwout00a.mat [new file with mode: 0644]
wlin/w_ss/lwout01a.mat [new file with mode: 0644]
wlin/w_ss/lwout02a.mat [new file with mode: 0644]
wlin/w_ss/lwout03a.mat [new file with mode: 0644]
wlin/w_ss/lwout04a.mat [new file with mode: 0644]
wlin/w_ss/lwout05a.mat [new file with mode: 0644]
wlin/w_ss/lwout06a.mat [new file with mode: 0644]
wlin/w_ss/lwout07a.mat [new file with mode: 0644]
wlin/w_ss/lwout08a.mat [new file with mode: 0644]
wlin/w_ss/lwout09a.mat [new file with mode: 0644]
wlin/w_ss/lwout10a.mat [new file with mode: 0644]
wlin/w_ss/lwout11a.mat [new file with mode: 0644]
wlin/w_ss/lwout12a.mat [new file with mode: 0644]
wlin/w_ss/lwout13a.mat [new file with mode: 0644]
wlin/w_ss/lwout14a.mat [new file with mode: 0644]

diff --git a/00README b/00README
new file mode 100644 (file)
index 0000000..a853eaf
--- /dev/null
+++ b/00README
@@ -0,0 +1,260 @@
+* 0. Introduction
+This directory contains a computer program for predicting one-dimensional 
+protein structures (secondary structures [SS], contact numbers [CN], and 
+residue-wise contact orders [RWCO]) by the method of critical random networks 
+described in:
+
+Ref. 1 (Description of the software)
+  "CRNPRED: Highly accurate prediction of one-dimensional protein structures
+    by large-scale critical random networks."
+  Kinjo AR, Nishikawa K.
+  submitted (2006)
+
+and 
+
+Ref. 2 (Method of critical random networks)
+  "Predicting secondary structures, contact numbers, and residue-wise contact 
+    orders of native protein structure from amino acid sequence using critical 
+    random networks."
+  Kinjo AR, Nishikawa K.
+  BIOPHYSICS, 1:67-74 (2005) (DOI: 10.2142/biophysics.1.67).
+
+This software is in public domain. You can use, modify and/or destroy it freely,
+but we do not take any responsibility for the consequences of your use.
+
+* 1. INSTALLING CRNPRED.
+ To install the CRNPRED program, you need the following:
+ (0) UNIX-like operating system (Linux, MacOS X, *BSD, etc.)
+ (1) bash (or zsh)
+ (2) make
+ (3) gcc 
+ (4) PSI-BLAST and related databases (amino acid sequences and BLOSUM 
+     scoring matrices).
+
+  First, set the environment variable CRNPRED_DIR to this directory (that is,
+  the directory containing this file "00README").
+  If you are using sh, ksh, bash, or zsh, write
+
+    export CRNPRED_DIR=/path/to/this/directory
+
+  in your ~/.profile and do 
+       % . ~/.profile
+
+  If you are using csh or tcsh, write
+
+    setenv CRNPRED_DIR /path/to/this/directory
+
+  in your ~/.cshrc and do
+       % source ~/.cshrc
+
+  To compile the program, do 
+
+       % ./make.sh
+
+  Then the program named "xpredm" is installed under the directory 
+  ${CRNPRED_DIR}/bin.
+
+   After xpredm has been installed, test it by running
+
+        % ${CRNPRED_DIR}/bin/xpredm sample/d3nul__.prof > hoge.out
+  
+   Compare hoge.out with sample/d3nul__.out. There are a few sample 
+   inputs and outputs in the directory named "sample".
+
+* 2. RUNNING CRNPRED.  
+  Make sure you have set the environment variable CRNPRED_DIR appropriately.
+  A utility shell script "run_crn.sh" is available for your convenience.
+  If you have FASTA format amino acid sequence file (say, "test.seq"), do
+
+  ${CRNPRED_DIR}/bin/run_crn.sh -d uniref100 test.seq 
+
+  where "uniref100" is the sequence database used by PSI-BLAST. 
+  Then, after some time,  you have a file named "test.seq.d.out" which contains
+  the result of the prediction. If it does not work, check the content of 
+  "run_crn.sh" and modify the environment variables such as BLASTDB, BLASTMAT, 
+  and CRNPRED_DIR, or you may have to change the first line "#!/bin/sh" to 
+  something like "#!/usr/bin/env bash" or "#!/usr/bin/env/ zsh".
+  Run 
+    ${CRNPRED_DIR}/bin/run_crn.sh -h
+  to see other options.
+
+  Alternatively, you can directly run the program. You first need to run 
+  PSI-BLAST to make a position-specific scoring matrix:
+
+  blastpgp -d nr -h 0.0005 -j 3 -i test.seq -Q test.prof > /dev/null 
+
+  Then do 
+
+  ${CRNPRED_DIR}/bin/xpredm test.prof > test.out
+
+  The result is saved in "test.out".
+
+* 3. INTERPRETING THE RESULTS.
+  Below is an example of prediction.
+
+    * Lines starting with "AA" show the amino acid sequence you fed.
+    * Lines starting with "SS" show the predicted secondary structures 
+      where "H", "E", and "C" mean "alpha-helix", "beta-strand", and "coils", 
+      respectively.
+    * Lines starting with "CN" show the predicted contact numbers in 2-state 
+      description where "B" and "E" mean "buried" and "exposed", respectively. 
+      The threshold values are the average contact number for each residue 
+      type (see Appendix below for the list of the average contact numbers).
+    * Lines after "># AA : SS P_H P_E P_C : CN : RWCO" are the details of the 
+      prediction:
+          o The column corresponding to "AA" indicates the residue numbers 
+            and the amino acid residues.
+          o The column corresponding to "SS" indicates the predicted secondary 
+            structure followed by the ad hoc probability for each secondary 
+            structure class (i.e., "P_H" for the probability for the residue to
+            be in the alpha-helix class, etc.).
+          o The column corresponding to "CN" indicates the predicted contact 
+            numbers in 2-state description ("B" or "E") followed by the real 
+            predicted contact numbers.
+          o The column corresponding to "RWCO" indicates the predicted 
+            residue-wise contact orders (real numbers). 
+
+---------sample output starts here--------
+>prediction for: test.prof
+
+
+#                  *         *         *         *         *         *
+AA:       SWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFLA
+SS:       CCHHHHHHHHHCCCCCCCCHEEEEECCCCCEEEECCCCCCCCHHHHHHHHHCCCCCCCCC
+CN:       BBBBBBEBBEBBBBBBBBEEEEEEEEEEEEEEEEEBBBBBEEBBEBBBEEBEBBBBBBBB
+#                  *         *         *         *         *         *
+AA:       PTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVER
+SS:       CCEEEECCCEEEEEECCCCEEEEECCCCCEEEEEECCCEEEEEEECCCCCCHHHHHHHHH
+CN:       EBEEBEBBEEEEEEEBBBBBBEEEEEBBBEEEEEEEEEEEEEEEBBBBBBBBEEEBEEEB
+#                  *
+AA:       LGDYLIESEL
+SS:       HHHHHHHCCC
+CN:       EEEBEBBBBB
+//
+
+>#   AA : SS P_H P_E P_C : CN     : RWCO
+    1 S : C   11   7  82 : B   14 :  840
+    2 W : C   23  10  67 : B   22 : 1221
+    3 Q : H   59  11  30 : B   18 :  864
+    4 S : H   79   8  12 : B   18 :  860
+    5 Y : H   86   6   7 : B   25 : 1199
+    6 V : H   89   5   6 : B   27 : 1276
+    7 D : H   90   5   6 : E   21 :  855
+    8 D : H   90   4   6 : B   17 :  728
+    9 H : H   89   5   6 : B   22 :  954
+   10 L : H   85   6   8 : E   30 : 1188
+   11 M : H   72   9  18 : B   24 :  850
+   12 C : C   44  11  46 : B   22 :  826
+   13 D : C   18   8  73 : B   18 :  669
+   14 V : C   10   7  83 : B   22 :  751
+   15 E : C    8   6  86 : B   17 :  593
+   16 G : C    8   7  85 : B   18 :  640
+   17 N : C   10   8  82 : B   17 :  696
+   18 H : C   16  11  73 : B   24 :  808
+   19 L : C   30  16  54 : E   32 : 1103
+   20 T : H   45  22  32 : E   26 :  962
+   21 A : E   37  43  20 : E   27 : 1017
+   22 A : E   15  75  10 : E   37 : 1265
+   23 A : E    7  88   5 : E   38 : 1286
+   24 I : E    6  89   5 : E   41 : 1341
+   .
+   .
+   .
+   .
+---------sample output ends here--------
+
+* 4. CONTACT INFORMATION
+
+Akira Kinjo
+Center for Information Biology and DNA Data Bank of Japan,
+National Institute of Genetics,
+Mishima, 411-8540, JAPAN
+email: akinjo @ genes . nig . ac . jp
+
+* Appendix A.
+ The average contact number of each residue type is listed below:
+-------------------
+  25.430 , /* A */
+  21.038 , /* R */
+  20.093 , /* N */
+  18.594 , /* D */
+  29.647 , /* C */
+  20.206 , /* Q */
+  18.008 , /* E */
+  22.505 , /* G */
+  23.572 , /* H */
+  29.469 , /* I */
+  28.173 , /* L */
+  18.452 , /* K */
+  26.466 , /* M */
+  28.057 , /* F */
+  20.350 , /* P */
+  21.420 , /* S */
+  22.747 , /* T */
+  26.913 , /* W */
+  26.627 , /* Y */
+  28.656 , /* V */
+-------------------
+
+* Appendix B.
+** Faster but less accurate predictions.
+The default implementation of CRNPRED uses 5000 dimensional state vectors for
+critical random networks. This makes the prediction process quite slow when 
+you use the program on old computers or when you predict large proteins.
+
+If you want predictions quickly, there are two options: 
+(1) linear predictor or (2) 2000 dimensional state vectors.
+
+*** Using linear predictor
+The linear predictor as described in Ref. 2 is implemented as a separate 
+program named "lpredm" which is installed along with xpredm (CRNPRED).
+Use it as follows:
+  ${CRNPRED_DIR}/bin/lpredm test.prof > test.out
+
+*** Using 2000 dimensional CRNPRED
+To use CRNPRED with 2000 dimensional state vectors, you need to recompile the 
+program. Do it as follows:
+  cd ${CRNPRED_DIR}/src
+  make realclean
+  make NDIM=2000 install
+  cd ..
+  cp w2000/WMATS .
+  cp w2000/WMAT_ENS .
+
+This produces the executable file "xpredm" just like before, but it now 
+uses 2000-dimensional state vectors.
+
+*** Comparison of predictors
+Here is a brief summary of speed and accuracy of the linear predictor (lpredm),
+xpredm(2000),  and xpredm (5000). The CPU times were measured for 
+the sample file "sample/d8abp__.prof" (305 AA) on Mac OS X (PPC G5, 2.5GHz).
+The CPU time is (almost) linearly proportional to the protein length.
+
+
+program               speed            accuracy        note 
+--------------------------------------------------------------
+xpredm         very slow       SS:Q3=81        default
+(5000)         5min52s         CN:Cor=0.75
+                               RWCO:Cor=0.61   
+
+xpredm         slow            SS:Q3=79        
+(2000)         1min12s         CN:Cor=0.74
+                               RWCO:Cor=0.61   
+
+lpredm         fast            SS:Q3=76        
+               0.558s          CN:Cor=0.72
+                               RWCO:Cor=0.59   
+--------------------------------------------------------------
+
+Note that the accuracies are the average values based on a benchmark.
+The difference between Q3=81 and Q3=79 may seem insignificant on average, but 
+there can be a big difference for individual predictions [e.g., an incorrectly
+predicted alpha helix with xpred(2000) may be correctly predicted as a beta
+strand with xpred(5000)].
+
+Updated: 2009-06-10
+
+# Local variables:
+# mode: outline
+# End:
diff --git a/WMATS b/WMATS
new file mode 100644 (file)
index 0000000..c7e7947
--- /dev/null
+++ b/WMATS
@@ -0,0 +1,20 @@
+w5000/Mat/wmat5000_50_1.0a.mat w5000/Mat/win5000_21.0.01a.mat  w5000/w_ss/xwoutalla.mat        w5000/w_cn/xwoutalla.mat        w5000/w_rwco/xwoutalla.mat
+w5000/Mat/wmat5000_50_1.0b.mat w5000/Mat/win5000_21.0.01b.mat  w5000/w_ss/xwoutallb.mat        w5000/w_cn/xwoutallb.mat        w5000/w_rwco/xwoutallb.mat
+w5000/Mat/wmat5000_50_1.0c.mat w5000/Mat/win5000_21.0.01c.mat  w5000/w_ss/xwoutallc.mat        w5000/w_cn/xwoutallc.mat        w5000/w_rwco/xwoutallc.mat
+w5000/Mat/wmat5000_50_1.0d.mat w5000/Mat/win5000_21.0.01d.mat  w5000/w_ss/xwoutalld.mat        w5000/w_cn/xwoutalld.mat        w5000/w_rwco/xwoutalld.mat
+w5000/Mat/wmat5000_50_1.0e.mat w5000/Mat/win5000_21.0.01e.mat  w5000/w_ss/xwoutalle.mat        w5000/w_cn/xwoutalle.mat        w5000/w_rwco/xwoutalle.mat
+w5000/Mat/wmat5000_50_1.0f.mat w5000/Mat/win5000_21.0.01f.mat  w5000/w_ss/xwoutallf.mat        w5000/w_cn/xwoutallf.mat        w5000/w_rwco/xwoutallf.mat
+w5000/Mat/wmat5000_50_1.0g.mat w5000/Mat/win5000_21.0.01g.mat  w5000/w_ss/xwoutallg.mat        w5000/w_cn/xwoutallg.mat        w5000/w_rwco/xwoutallg.mat
+w5000/Mat/wmat5000_50_1.0h.mat w5000/Mat/win5000_21.0.01h.mat  w5000/w_ss/xwoutallh.mat        w5000/w_cn/xwoutallh.mat        w5000/w_rwco/xwoutallh.mat
+w5000/Mat/wmat5000_50_1.0i.mat w5000/Mat/win5000_21.0.01i.mat  w5000/w_ss/xwoutalli.mat        w5000/w_cn/xwoutalli.mat        w5000/w_rwco/xwoutalli.mat
+w5000/Mat/wmat5000_50_1.0j.mat w5000/Mat/win5000_21.0.01j.mat  w5000/w_ss/xwoutallj.mat        w5000/w_cn/xwoutallj.mat        w5000/w_rwco/xwoutallj.mat
+w5000/Mat/wmat5000_50_1.0k.mat w5000/Mat/win5000_21.0.01k.mat  w5000/w_ss/xwoutallk.mat        w5000/w_cn/xwoutallk.mat        w5000/w_rwco/xwoutallk.mat
+w5000/Mat/wmat5000_50_1.0l.mat w5000/Mat/win5000_21.0.01l.mat  w5000/w_ss/xwoutalll.mat        w5000/w_cn/xwoutalll.mat        w5000/w_rwco/xwoutalll.mat
+w5000/Mat/wmat5000_50_1.0m.mat w5000/Mat/win5000_21.0.01m.mat  w5000/w_ss/xwoutallm.mat        w5000/w_cn/xwoutallm.mat        w5000/w_rwco/xwoutallm.mat
+w5000/Mat/wmat5000_50_1.0n.mat w5000/Mat/win5000_21.0.01n.mat  w5000/w_ss/xwoutalln.mat        w5000/w_cn/xwoutalln.mat        w5000/w_rwco/xwoutalln.mat
+w5000/Mat/wmat5000_50_1.0o.mat w5000/Mat/win5000_21.0.01o.mat  w5000/w_ss/xwoutallo.mat        w5000/w_cn/xwoutallo.mat        w5000/w_rwco/xwoutallo.mat
+w5000/Mat/wmat5000_50_1.0p.mat w5000/Mat/win5000_21.0.01p.mat  w5000/w_ss/xwoutallp.mat        w5000/w_cn/xwoutallp.mat        w5000/w_rwco/xwoutallp.mat
+w5000/Mat/wmat5000_50_1.0q.mat w5000/Mat/win5000_21.0.01q.mat  w5000/w_ss/xwoutallq.mat        w5000/w_cn/xwoutallq.mat        w5000/w_rwco/xwoutallq.mat
+w5000/Mat/wmat5000_50_1.0r.mat w5000/Mat/win5000_21.0.01r.mat  w5000/w_ss/xwoutallr.mat        w5000/w_cn/xwoutallr.mat        w5000/w_rwco/xwoutallr.mat
+w5000/Mat/wmat5000_50_1.0s.mat w5000/Mat/win5000_21.0.01s.mat  w5000/w_ss/xwoutalls.mat        w5000/w_cn/xwoutalls.mat        w5000/w_rwco/xwoutalls.mat
+w5000/Mat/wmat5000_50_1.0t.mat w5000/Mat/win5000_21.0.01t.mat  w5000/w_ss/xwoutallt.mat        w5000/w_cn/xwoutallt.mat        w5000/w_rwco/xwoutallt.mat
diff --git a/WMATS2000 b/WMATS2000
new file mode 100644 (file)
index 0000000..f5afa6b
--- /dev/null
+++ b/WMATS2000
@@ -0,0 +1,20 @@
+w2000/Mat/wmat2000_20_1.0a.mat w2000/Mat/win2000_21.0.01a.mat  w2000/w_ss/xwoutalla.mat        w2000/w_cn/xwoutalla.mat        w2000/w_rwco/xwoutalla.mat
+w2000/Mat/wmat2000_20_1.0b.mat w2000/Mat/win2000_21.0.01b.mat  w2000/w_ss/xwoutallb.mat        w2000/w_cn/xwoutallb.mat        w2000/w_rwco/xwoutallb.mat
+w2000/Mat/wmat2000_20_1.0c.mat w2000/Mat/win2000_21.0.01c.mat  w2000/w_ss/xwoutallc.mat        w2000/w_cn/xwoutallc.mat        w2000/w_rwco/xwoutallc.mat
+w2000/Mat/wmat2000_20_1.0d.mat w2000/Mat/win2000_21.0.01d.mat  w2000/w_ss/xwoutalld.mat        w2000/w_cn/xwoutalld.mat        w2000/w_rwco/xwoutalld.mat
+w2000/Mat/wmat2000_20_1.0e.mat w2000/Mat/win2000_21.0.01e.mat  w2000/w_ss/xwoutalle.mat        w2000/w_cn/xwoutalle.mat        w2000/w_rwco/xwoutalle.mat
+w2000/Mat/wmat2000_20_1.0f.mat w2000/Mat/win2000_21.0.01f.mat  w2000/w_ss/xwoutallf.mat        w2000/w_cn/xwoutallf.mat        w2000/w_rwco/xwoutallf.mat
+w2000/Mat/wmat2000_20_1.0g.mat w2000/Mat/win2000_21.0.01g.mat  w2000/w_ss/xwoutallg.mat        w2000/w_cn/xwoutallg.mat        w2000/w_rwco/xwoutallg.mat
+w2000/Mat/wmat2000_20_1.0h.mat w2000/Mat/win2000_21.0.01h.mat  w2000/w_ss/xwoutallh.mat        w2000/w_cn/xwoutallh.mat        w2000/w_rwco/xwoutallh.mat
+w2000/Mat/wmat2000_20_1.0i.mat w2000/Mat/win2000_21.0.01i.mat  w2000/w_ss/xwoutalli.mat        w2000/w_cn/xwoutalli.mat        w2000/w_rwco/xwoutalli.mat
+w2000/Mat/wmat2000_20_1.0j.mat w2000/Mat/win2000_21.0.01j.mat  w2000/w_ss/xwoutallj.mat        w2000/w_cn/xwoutallj.mat        w2000/w_rwco/xwoutallj.mat
+w2000/Mat/wmat2000_20_1.0k.mat w2000/Mat/win2000_21.0.01k.mat  w2000/w_ss/xwoutallk.mat        w2000/w_cn/xwoutallk.mat        w2000/w_rwco/xwoutallk.mat
+w2000/Mat/wmat2000_20_1.0l.mat w2000/Mat/win2000_21.0.01l.mat  w2000/w_ss/xwoutalll.mat        w2000/w_cn/xwoutalll.mat        w2000/w_rwco/xwoutalll.mat
+w2000/Mat/wmat2000_20_1.0m.mat w2000/Mat/win2000_21.0.01m.mat  w2000/w_ss/xwoutallm.mat        w2000/w_cn/xwoutallm.mat        w2000/w_rwco/xwoutallm.mat
+w2000/Mat/wmat2000_20_1.0n.mat w2000/Mat/win2000_21.0.01n.mat  w2000/w_ss/xwoutalln.mat        w2000/w_cn/xwoutalln.mat        w2000/w_rwco/xwoutalln.mat
+w2000/Mat/wmat2000_20_1.0o.mat w2000/Mat/win2000_21.0.01o.mat  w2000/w_ss/xwoutallo.mat        w2000/w_cn/xwoutallo.mat        w2000/w_rwco/xwoutallo.mat
+w2000/Mat/wmat2000_20_1.0p.mat w2000/Mat/win2000_21.0.01p.mat  w2000/w_ss/xwoutallp.mat        w2000/w_cn/xwoutallp.mat        w2000/w_rwco/xwoutallp.mat
+w2000/Mat/wmat2000_20_1.0q.mat w2000/Mat/win2000_21.0.01q.mat  w2000/w_ss/xwoutallq.mat        w2000/w_cn/xwoutallq.mat        w2000/w_rwco/xwoutallq.mat
+w2000/Mat/wmat2000_20_1.0r.mat w2000/Mat/win2000_21.0.01r.mat  w2000/w_ss/xwoutallr.mat        w2000/w_cn/xwoutallr.mat        w2000/w_rwco/xwoutallr.mat
+w2000/Mat/wmat2000_20_1.0s.mat w2000/Mat/win2000_21.0.01s.mat  w2000/w_ss/xwoutalls.mat        w2000/w_cn/xwoutalls.mat        w2000/w_rwco/xwoutalls.mat
+w2000/Mat/wmat2000_20_1.0t.mat w2000/Mat/win2000_21.0.01t.mat  w2000/w_ss/xwoutallt.mat        w2000/w_cn/xwoutallt.mat        w2000/w_rwco/xwoutallt.mat
diff --git a/WMATS5000 b/WMATS5000
new file mode 100644 (file)
index 0000000..c7e7947
--- /dev/null
+++ b/WMATS5000
@@ -0,0 +1,20 @@
+w5000/Mat/wmat5000_50_1.0a.mat w5000/Mat/win5000_21.0.01a.mat  w5000/w_ss/xwoutalla.mat        w5000/w_cn/xwoutalla.mat        w5000/w_rwco/xwoutalla.mat
+w5000/Mat/wmat5000_50_1.0b.mat w5000/Mat/win5000_21.0.01b.mat  w5000/w_ss/xwoutallb.mat        w5000/w_cn/xwoutallb.mat        w5000/w_rwco/xwoutallb.mat
+w5000/Mat/wmat5000_50_1.0c.mat w5000/Mat/win5000_21.0.01c.mat  w5000/w_ss/xwoutallc.mat        w5000/w_cn/xwoutallc.mat        w5000/w_rwco/xwoutallc.mat
+w5000/Mat/wmat5000_50_1.0d.mat w5000/Mat/win5000_21.0.01d.mat  w5000/w_ss/xwoutalld.mat        w5000/w_cn/xwoutalld.mat        w5000/w_rwco/xwoutalld.mat
+w5000/Mat/wmat5000_50_1.0e.mat w5000/Mat/win5000_21.0.01e.mat  w5000/w_ss/xwoutalle.mat        w5000/w_cn/xwoutalle.mat        w5000/w_rwco/xwoutalle.mat
+w5000/Mat/wmat5000_50_1.0f.mat w5000/Mat/win5000_21.0.01f.mat  w5000/w_ss/xwoutallf.mat        w5000/w_cn/xwoutallf.mat        w5000/w_rwco/xwoutallf.mat
+w5000/Mat/wmat5000_50_1.0g.mat w5000/Mat/win5000_21.0.01g.mat  w5000/w_ss/xwoutallg.mat        w5000/w_cn/xwoutallg.mat        w5000/w_rwco/xwoutallg.mat
+w5000/Mat/wmat5000_50_1.0h.mat w5000/Mat/win5000_21.0.01h.mat  w5000/w_ss/xwoutallh.mat        w5000/w_cn/xwoutallh.mat        w5000/w_rwco/xwoutallh.mat
+w5000/Mat/wmat5000_50_1.0i.mat w5000/Mat/win5000_21.0.01i.mat  w5000/w_ss/xwoutalli.mat        w5000/w_cn/xwoutalli.mat        w5000/w_rwco/xwoutalli.mat
+w5000/Mat/wmat5000_50_1.0j.mat w5000/Mat/win5000_21.0.01j.mat  w5000/w_ss/xwoutallj.mat        w5000/w_cn/xwoutallj.mat        w5000/w_rwco/xwoutallj.mat
+w5000/Mat/wmat5000_50_1.0k.mat w5000/Mat/win5000_21.0.01k.mat  w5000/w_ss/xwoutallk.mat        w5000/w_cn/xwoutallk.mat        w5000/w_rwco/xwoutallk.mat
+w5000/Mat/wmat5000_50_1.0l.mat w5000/Mat/win5000_21.0.01l.mat  w5000/w_ss/xwoutalll.mat        w5000/w_cn/xwoutalll.mat        w5000/w_rwco/xwoutalll.mat
+w5000/Mat/wmat5000_50_1.0m.mat w5000/Mat/win5000_21.0.01m.mat  w5000/w_ss/xwoutallm.mat        w5000/w_cn/xwoutallm.mat        w5000/w_rwco/xwoutallm.mat
+w5000/Mat/wmat5000_50_1.0n.mat w5000/Mat/win5000_21.0.01n.mat  w5000/w_ss/xwoutalln.mat        w5000/w_cn/xwoutalln.mat        w5000/w_rwco/xwoutalln.mat
+w5000/Mat/wmat5000_50_1.0o.mat w5000/Mat/win5000_21.0.01o.mat  w5000/w_ss/xwoutallo.mat        w5000/w_cn/xwoutallo.mat        w5000/w_rwco/xwoutallo.mat
+w5000/Mat/wmat5000_50_1.0p.mat w5000/Mat/win5000_21.0.01p.mat  w5000/w_ss/xwoutallp.mat        w5000/w_cn/xwoutallp.mat        w5000/w_rwco/xwoutallp.mat
+w5000/Mat/wmat5000_50_1.0q.mat w5000/Mat/win5000_21.0.01q.mat  w5000/w_ss/xwoutallq.mat        w5000/w_cn/xwoutallq.mat        w5000/w_rwco/xwoutallq.mat
+w5000/Mat/wmat5000_50_1.0r.mat w5000/Mat/win5000_21.0.01r.mat  w5000/w_ss/xwoutallr.mat        w5000/w_cn/xwoutallr.mat        w5000/w_rwco/xwoutallr.mat
+w5000/Mat/wmat5000_50_1.0s.mat w5000/Mat/win5000_21.0.01s.mat  w5000/w_ss/xwoutalls.mat        w5000/w_cn/xwoutalls.mat        w5000/w_rwco/xwoutalls.mat
+w5000/Mat/wmat5000_50_1.0t.mat w5000/Mat/win5000_21.0.01t.mat  w5000/w_ss/xwoutallt.mat        w5000/w_cn/xwoutallt.mat        w5000/w_rwco/xwoutallt.mat
diff --git a/WMATS_LIN b/WMATS_LIN
new file mode 100644 (file)
index 0000000..d8815a5
--- /dev/null
+++ b/WMATS_LIN
@@ -0,0 +1,15 @@
+wlin/w_ss/lwout00a.mat wlin/w_cn/lwout00a.mat  wlin/w_rwco/lwout00a.mat
+wlin/w_ss/lwout01a.mat wlin/w_cn/lwout01a.mat  wlin/w_rwco/lwout01a.mat
+wlin/w_ss/lwout02a.mat wlin/w_cn/lwout02a.mat  wlin/w_rwco/lwout02a.mat
+wlin/w_ss/lwout03a.mat wlin/w_cn/lwout03a.mat  wlin/w_rwco/lwout03a.mat
+wlin/w_ss/lwout04a.mat wlin/w_cn/lwout04a.mat  wlin/w_rwco/lwout04a.mat
+wlin/w_ss/lwout05a.mat wlin/w_cn/lwout05a.mat  wlin/w_rwco/lwout05a.mat
+wlin/w_ss/lwout06a.mat wlin/w_cn/lwout06a.mat  wlin/w_rwco/lwout06a.mat
+wlin/w_ss/lwout07a.mat wlin/w_cn/lwout07a.mat  wlin/w_rwco/lwout07a.mat
+wlin/w_ss/lwout08a.mat wlin/w_cn/lwout08a.mat  wlin/w_rwco/lwout08a.mat
+wlin/w_ss/lwout09a.mat wlin/w_cn/lwout09a.mat  wlin/w_rwco/lwout09a.mat
+wlin/w_ss/lwout10a.mat wlin/w_cn/lwout10a.mat  wlin/w_rwco/lwout10a.mat
+wlin/w_ss/lwout11a.mat wlin/w_cn/lwout11a.mat  wlin/w_rwco/lwout11a.mat
+wlin/w_ss/lwout12a.mat wlin/w_cn/lwout12a.mat  wlin/w_rwco/lwout12a.mat
+wlin/w_ss/lwout13a.mat wlin/w_cn/lwout13a.mat  wlin/w_rwco/lwout13a.mat
+wlin/w_ss/lwout14a.mat wlin/w_cn/lwout14a.mat  wlin/w_rwco/lwout14a.mat
diff --git a/WMAT_ENS b/WMAT_ENS
new file mode 100644 (file)
index 0000000..6c28135
--- /dev/null
+++ b/WMAT_ENS
@@ -0,0 +1,707 @@
+   1.3514628e-02  -3.3350560e-03  -8.0938522e-04   8.5123132e-02  -1.3573838e-01
+   1.2396980e-02   1.0397508e-02  -1.3424301e-02   9.3456578e-02  -6.3776155e-02
+   1.6603014e-02   1.3215659e-03  -8.5543931e-03   6.0953539e-02  -1.4449229e-01
+   3.1510270e-04  -2.6060103e-03   2.2909076e-03  -3.7375260e-03  -2.6138508e-02
+  -9.5787515e-04   1.1119903e-03  -1.5411511e-04   4.0898062e-04   2.2064951e-02
+   2.1309511e-02  -1.4252497e-03  -1.2874342e-02   5.1070626e-03  -8.2934620e-02
+   2.6408753e-02   1.6361477e-03  -2.1034981e-02  -3.4104624e-02  -1.0266902e-01
+   2.0259100e-02  -9.2545404e-04  -1.2323727e-02  -1.0074707e-02  -1.5386348e-01
+  -6.4815751e-03  -2.3001747e-03   8.7817498e-03  -1.0713363e-02   5.2197510e-02
+   9.4420697e-04   7.7298639e-04  -1.7171934e-03  -4.1442108e-03  -1.8655391e-02
+   3.0260088e-02  -7.7855907e-03  -9.3801205e-03   8.3227830e-02   2.5527295e-02
+   2.7145451e-02  -1.2092110e-02  -1.9589639e-03   7.7418828e-02  -1.6604317e-02
+   3.1047085e-02  -1.0718320e-02  -7.2343876e-03   4.9663390e-02  -1.0241386e-01
+   1.1328744e-03  -2.3927309e-03   1.2598565e-03  -7.0345248e-03  -2.4331367e-02
+  -2.4494332e-03   5.4956266e-04   1.8998706e-03  -2.9642229e-03   1.2841781e-02
+   1.1185432e-02   4.7229091e-04  -1.3840671e-02  -1.0335546e-01  -6.8555630e-02
+   4.0956825e-03   6.5537960e-03  -1.2832426e-02  -1.1148904e-01  -3.2800087e-02
+   7.7073365e-03   1.3306765e-03  -1.1220960e-02  -7.6808750e-02  -1.0969481e-02
+  -1.5996042e-03   4.5748815e-03  -2.9752773e-03   1.0159721e-02   2.8807520e-02
+   5.6548514e-04   4.1459593e-04  -9.8008107e-04  -5.2912395e-03   7.5123765e-03
+   1.7985902e-02   3.1918026e-04   2.6263188e-03  -1.0549296e-01  -4.5572044e-02
+   2.6137060e-02   5.9870885e-03  -1.1192747e-02  -7.7916532e-02   1.3718184e-01
+   2.1551803e-02  -2.6520847e-03   2.0316826e-03  -9.2151157e-02  -2.3503470e-02
+  -2.1042196e-03   4.4254639e-03  -2.3212443e-03   8.3100262e-03   7.4678240e-02
+  -1.3251673e-04  -1.2981266e-03   1.4306434e-03  -4.0868922e-03  -1.6466394e-02
+   8.4341394e-03  -6.4337694e-03  -1.6154554e-02  -5.3447934e-02  -1.6117313e-01
+  -1.6553145e-02  -8.8403254e-04   3.2829938e-03   2.0520386e-03  -8.9450780e-02
+  -8.3315468e-03  -2.0002983e-03  -3.8223391e-03  -2.9681113e-02  -9.2071557e-02
+   7.0287800e-03  -4.7719514e-03  -2.2568287e-03   5.0529029e-03  -2.1898205e-02
+  -2.3951430e-03   3.0770872e-03  -6.8194417e-04  -6.5556652e-03   3.7492339e-03
+   1.2822702e-02   8.6168228e-04  -2.6622506e-02  -2.9628393e-02  -3.8122313e-02
+   5.6842331e-03   2.6717174e-03  -2.1294072e-02  -1.9190398e-02  -5.1510736e-02
+   9.4292763e-03   5.1305104e-03  -2.7497908e-02  -1.2993047e-02   2.0510823e-02
+  -6.3164658e-03  -1.6435690e-04   6.4808227e-03  -4.4827571e-03   3.4431741e-02
+   1.1192280e-03  -2.7992701e-03   1.6800420e-03   1.2001012e-03  -2.4616864e-02
+   1.3771284e-02   5.3857847e-04  -3.8108736e-03  -1.1721452e-02  -3.4226766e-02
+   9.7307164e-03   1.1949420e-02  -1.1181148e-02  -1.9084529e-03  -4.0391769e-03
+   1.7771601e-02   5.9462420e-03  -1.3218854e-02   2.0516001e-03   1.4143871e-02
+  -1.0465479e-03  -1.4391148e-04   1.1904594e-03  -1.3082597e-03  -1.9845165e-02
+   9.2432110e-04   4.8534282e-04  -1.4096639e-03   4.0623704e-04   3.7096279e-03
+   7.4568280e-03   6.2660146e-03  -2.2888273e-02   8.9715768e-02   2.0391550e-02
+   2.7952997e-03   5.4457785e-03  -1.7406509e-02   8.8679629e-02  -1.3102448e-03
+   5.6782282e-03  -1.8053801e-03  -1.3038278e-02   4.4246144e-02  -4.7508460e-02
+   1.6236717e-03   2.5280890e-03  -4.1517607e-03   3.6594142e-02   4.8152213e-03
+  -6.0883260e-04  -4.3032212e-04   1.0391547e-03  -4.7685660e-03   6.9129229e-03
+   1.6110602e-02  -1.4044721e-03   3.7651278e-03  -2.4379428e-02  -9.9199485e-02
+   2.2622754e-02   2.6201482e-04  -4.4135106e-03  -1.4427644e-02  -1.1074134e-01
+   1.6564669e-02   3.3560218e-03  -1.4494330e-03   1.1225569e-02  -6.0281516e-02
+   1.0482868e-03  -2.0995818e-03   1.0512949e-03   2.2128500e-03   5.4026763e-02
+   1.7420971e-04   7.0715885e-04  -8.8136856e-04   6.1041003e-03   3.7990023e-04
+   1.0945893e-02  -8.1582477e-03  -1.1887085e-03  -2.1105578e-02  -6.8565145e-02
+   1.6726965e-03   1.5902844e-03  -1.6640442e-03  -6.5769641e-02  -1.4555100e-01
+   7.7972306e-03   1.8506756e-03  -8.0489695e-03  -3.4510794e-02  -8.8208515e-02
+  -2.2152985e-03  -4.8217959e-03   7.0370944e-03   7.9969750e-03  -7.9700536e-03
+   2.2123121e-03   2.8266656e-04  -2.4949786e-03  -6.2943969e-03  -1.1820191e-02
+   1.4873215e-02   1.7286559e-04  -2.5416740e-02   8.8946374e-02  -2.4236531e-02
+   7.5480800e-05   1.3683483e-02  -2.4129623e-02   1.2586207e-01  -3.3656928e-02
+   7.7456705e-03   8.0514407e-03  -2.6167771e-02   8.8277434e-02  -4.4500104e-02
+  -7.9620449e-04  -2.6585968e-03   3.4548013e-03  -6.9689218e-03  -9.9093940e-03
+   8.1623026e-04   1.1074425e-03  -1.9236727e-03   1.8457457e-03   5.0294443e-03
+   2.4034953e-02   1.5492667e-03  -7.4633992e-03  -1.1197070e-01  -2.1023852e-01
+   1.9973239e-02   1.2087551e-02  -1.3939970e-02  -1.3767564e-01  -3.3339668e-01
+   2.5802892e-02   1.5180030e-03  -9.2000749e-03  -1.2212495e-01  -2.8079074e-01
+  -1.5676981e-03  -4.1153799e-03   5.6830781e-03  -1.1799948e-02  -1.3223132e-02
+  -3.0774004e-04  -4.2455145e-04   7.3229149e-04   1.5685356e-02   3.0125932e-02
+   9.1052256e-04  -5.7233055e-03   1.0340279e-02  -3.7599577e-02  -1.8828668e-02
+  -6.0568126e-03   1.0987258e-03   1.0485583e-02  -3.0937990e-02   1.1910292e-02
+   3.1312975e-04   7.0196193e-03  -1.8052527e-03  -4.1914937e-03   5.7215135e-02
+   4.4327885e-03   2.7488403e-03  -7.1816288e-03   6.4818769e-03  -6.8308114e-03
+  -1.5210274e-03  -8.3050563e-04   2.3515330e-03   5.0828153e-04  -8.3550727e-03
+   1.7316755e-02  -1.3904905e-02   1.6703715e-02  -3.2721221e-02  -2.4539732e-01
+   1.9373952e-02  -1.9823004e-02   2.0564617e-02  -3.5056248e-02  -3.0491639e-01
+   2.2735885e-02  -1.2678159e-02   1.0057839e-02  -2.4707029e-02  -2.3157485e-01
+   3.6447253e-03  -3.6058643e-03  -3.8860940e-05   1.5351902e-02   1.4853376e-02
+   2.7859732e-04  -1.0273128e-03   7.4871545e-04  -1.1169460e-03  -6.6225970e-03
+   1.7637774e-02   1.7955384e-03  -4.9500004e-03  -3.6497856e-02  -1.2848924e-01
+   8.7442664e-03   1.4113074e-02  -8.3740284e-03  -5.5160191e-02  -1.0722888e-01
+   5.7657771e-03   4.5850114e-03   4.1325238e-03  -3.5270055e-02  -8.4981497e-02
+   6.3814328e-03  -7.3598810e-03   9.7844822e-04   2.1155418e-02  -1.1256094e-02
+  -1.1357670e-03   2.1306495e-03  -9.9488241e-04  -1.3131117e-02   2.8692117e-02
+   1.6468352e-02  -2.9920434e-03  -9.0532469e-03  -8.9787948e-02  -1.3736375e-01
+   9.8315195e-03   4.3299949e-03  -9.7384528e-03  -1.1261451e-01  -1.6673723e-01
+   9.5376161e-03   2.4001705e-03  -7.5147250e-03  -1.0999993e-01  -1.4730405e-01
+  -2.8931597e-03   4.4481730e-03  -1.5550133e-03  -2.2074158e-02  -1.3963280e-01
+  -5.0632485e-04   1.7178474e-03  -1.2115226e-03  -4.3454303e-03   1.5781627e-02
+   1.4318485e-02  -6.8596454e-03   1.4864397e-02   3.3739168e-02  -4.8844966e-02
+   2.0597596e-02  -5.1807022e-03   6.9063431e-03   2.6443396e-03  -1.8586066e-01
+   1.8852643e-02  -6.2836676e-03   9.7542618e-03   2.2630517e-02  -1.1339133e-01
+  -8.4981433e-05   5.0938795e-04  -4.2440652e-04  -1.0060859e-02  -5.3057964e-03
+   1.7566200e-03   6.2459089e-04  -2.3812108e-03   1.4290960e-03   5.0699437e-03
+   1.9309047e-03  -2.1286509e-03  -2.6398939e-03   1.0639980e-01   1.2150557e-02
+   7.7268136e-03  -1.6251855e-02   5.6874017e-03   1.3382264e-01   1.7233072e-01
+   1.4936217e-02  -8.7318368e-03  -9.0420203e-03   9.9898035e-02   6.2289052e-02
+   4.0823782e-03   1.0051586e-03  -5.0875368e-03  -9.5041529e-03  -3.5866580e-02
+   1.8164034e-03  -2.1654456e-04  -1.5998588e-03   9.4854225e-03   1.3188336e-02
+   2.4744252e-02   4.1342085e-05  -2.6668946e-02  -5.6955956e-02  -1.3605731e-01
+   2.8140583e-02  -6.4155149e-03  -2.3608420e-02  -1.1483352e-01  -3.2714060e-01
+   2.4815935e-02  -4.3480142e-03  -2.2351274e-02  -5.4540412e-02  -1.8178056e-01
+  -7.5968822e-04  -2.9151394e-03   3.6748276e-03   1.2821791e-02  -2.1608205e-02
+  -2.1634725e-04  -1.0831611e-03   1.2995083e-03  -6.1717007e-04   2.4995817e-02
+   3.0116301e-01  -2.7708945e-02  -1.6101784e-01  -1.4175536e-01  -1.7457151e+00
+  -1.5383699e-02   7.6256774e-03  -1.9228953e-02   1.1199398e-01   1.8934358e-01
+  -1.5429883e-02   7.5385557e-03  -1.9095649e-02   1.5554975e-01   3.1861209e-01
+  -1.1893205e-02   6.7489114e-03  -2.1842682e-02   1.2832275e-01   2.1953939e-01
+  -3.7372243e-03  -9.1804205e-04   4.6552664e-03   7.1321674e-03  -3.8324186e-02
+   7.9601870e-04   6.1797701e-04  -1.4139957e-03  -2.3647609e-03   1.4419992e-02
+  -2.5417235e-03   1.1632374e-02  -3.2571505e-02  -1.9480861e-03   1.6513158e-01
+  -7.6634942e-03   9.8579514e-03  -2.5675312e-02   5.0568977e-03   2.5847505e-01
+  -1.2110502e-02   1.1694432e-02  -2.3064786e-02  -1.3063341e-02   1.6803628e-01
+  -2.2220475e-04   4.5249782e-03  -4.3027735e-03  -2.3696844e-03   3.2732546e-02
+   1.1194000e-03  -1.3246368e-03   2.0523682e-04   2.5070529e-03   9.5748041e-03
+  -1.7561659e-02   1.4477534e-02  -3.0633891e-02   9.7372575e-02   3.2426731e-01
+  -1.0399218e-02   1.1744356e-02  -3.5063155e-02   6.7161028e-02   2.9383179e-01
+  -1.7575585e-02   8.3300981e-03  -2.4472530e-02   8.5275038e-02   2.6690837e-01
+  -1.4307378e-03   1.6621283e-03  -2.3139045e-04  -1.0014786e-02   4.3698132e-03
+   7.1339824e-06   3.9877494e-04  -4.0590893e-04   9.2378211e-03   1.3259995e-02
+  -1.5524542e-02   9.9057964e-03  -1.4640857e-02  -9.7538674e-02   1.6317425e-01
+  -2.0034740e-02   6.4136911e-03  -6.6385534e-03  -8.4235270e-02   1.5727395e-01
+  -1.6467264e-02   3.4826855e-03  -7.2750236e-03  -9.2992458e-02   1.7329315e-01
+   2.3828438e-03  -1.4535052e-03  -9.2933856e-04   5.9311742e-04   2.1763270e-02
+  -1.9830587e-03   2.5309331e-03  -5.4787446e-04  -2.0394165e-03   6.2774765e-03
+  -9.5606955e-03   2.4030602e-02  -4.4936640e-02  -2.9489481e-02   3.8051147e-01
+  -1.1470138e-02   3.0477343e-02  -4.9473938e-02  -5.4574047e-03   4.9684947e-01
+  -1.3896046e-02   1.8461175e-02  -3.5031862e-02  -2.8105611e-02   3.7547757e-01
+   7.4706523e-04   6.6719695e-03  -7.4190348e-03   6.2145782e-03   5.1724722e-02
+  -4.7659925e-04  -1.7920697e-03   2.2686689e-03  -1.1462401e-02  -2.2332329e-02
+  -1.5435822e-02   1.0278759e-02  -1.9892654e-02   7.7181844e-02   2.0751400e-01
+  -2.8636214e-02   2.1963037e-02  -1.8376540e-02   1.1153760e-01   3.0202807e-01
+  -2.3032748e-02   1.2955325e-02  -1.4972293e-02   6.9908152e-02   2.1006461e-01
+   7.5865258e-03  -2.0856367e-05  -7.5656694e-03   2.9951449e-02   3.9352555e-02
+  -4.0131341e-03  -3.9401517e-04   4.4071493e-03  -8.1733320e-03  -9.8118579e-03
+  -9.0321778e-03  -7.5836985e-03   6.9558597e-03   7.2118724e-04   3.4301299e-02
+  -1.1553249e-02  -9.9539392e-03   1.1847172e-02   1.6062443e-02   4.0862755e-02
+  -1.1753099e-02  -4.5763716e-03   6.6694541e-03   1.0978596e-02   5.6008327e-02
+  -3.7435092e-03  -4.1577678e-03   7.9012770e-03   1.1312705e-02   4.6809177e-02
+  -3.3853545e-05   2.8591425e-03  -2.8252889e-03  -1.3169088e-02  -2.3649707e-02
+  -5.3796145e-03   5.0228594e-03  -2.0915882e-02   4.0555124e-02   1.9954141e-01
+  -5.5700157e-03   7.5141504e-03  -2.3216772e-02   4.8795674e-02   1.9872005e-01
+  -8.0478895e-03   5.8839809e-03  -1.9108729e-02   3.3745669e-02   1.9175708e-01
+   2.8606103e-03  -6.6849624e-03   3.8243521e-03  -3.5164089e-03  -2.5222980e-02
+  -1.0358264e-04   2.8763913e-03  -2.7728086e-03   3.6198565e-03  -2.1305105e-03
+  -1.0735211e-02   1.0020635e-02  -1.4584666e-02   3.8015006e-02   1.2464686e-01
+  -1.7768954e-02   1.1926460e-02  -9.4567475e-03   7.1288616e-02   7.1172640e-02
+  -1.2461949e-02   6.6063591e-03  -9.4436521e-03   3.3088975e-02   5.3972127e-02
+   2.3766585e-03   2.9447021e-04  -2.6711287e-03   3.9107810e-03   9.6115201e-03
+  -1.3826346e-04  -7.9871572e-04   9.3697918e-04   5.6955514e-03   4.9321503e-03
+  -8.2311787e-03   5.4688574e-03  -2.1989574e-02   3.4318939e-03   1.4213111e-01
+  -9.4197763e-03   1.6028447e-02  -3.1360566e-02   1.6810146e-02   2.0174925e-01
+  -9.8828895e-03   1.4661953e-02  -2.9530959e-02   4.0713492e-02   2.1955233e-01
+  -4.7451402e-03   7.9790524e-05   4.6653497e-03   1.6911402e-02   1.4801230e-02
+   2.1672071e-03  -1.2076962e-03  -9.5951095e-04   1.2563381e-03  -6.0493463e-03
+  -2.1100039e-02   2.9023653e-03  -1.0702952e-02   7.9056918e-02   1.5231092e-01
+  -3.5420147e-02   1.1420278e-02  -4.9007569e-03   5.0772568e-02   1.4620550e-01
+  -3.3015692e-02   8.8772841e-03  -4.7622186e-03   4.0655266e-02   1.3921099e-01
+  -2.4656609e-03   2.6404439e-03  -1.7478295e-04   9.2520584e-03   1.6946782e-02
+   1.1737594e-03  -2.3672648e-03   1.1935054e-03  -1.5562535e-03  -1.4007530e-02
+  -1.7863125e-02  -7.2636941e-07  -6.9573765e-03   7.3455732e-02   2.4296533e-01
+  -2.8357964e-02   1.2658249e-02  -9.1215137e-03   1.1075259e-01   2.9190245e-01
+  -2.1897482e-02   8.1621768e-03  -1.1085922e-02   7.4076625e-02   2.4309564e-01
+   4.6477950e-03   7.1484577e-03  -1.1796253e-02  -2.9126263e-03   1.3077829e-02
+  -1.0991910e-03  -2.7533226e-03   3.8525136e-03   1.4733253e-02   1.9959632e-02
+  -2.0235729e-02   1.8310005e-02  -3.4762660e-02   3.0079215e-02   3.3042282e-01
+  -3.2228204e-02   3.2700199e-02  -3.7160380e-02   3.2513169e-02   3.7651602e-01
+  -2.2838954e-02   2.1222486e-02  -3.5071916e-02   2.0418746e-02   3.1019086e-01
+   2.7457566e-03  -3.6313008e-03   8.8554415e-04  -6.1752726e-03   1.1311471e-02
+  -1.1489465e-03   1.6650868e-03  -5.1614021e-04   9.6997001e-04  -4.2839128e-03
+  -1.6630812e-02  -7.5947119e-04   1.0358195e-02  -1.9680501e-02   4.8393713e-02
+  -1.6374568e-02   1.8602804e-03   7.4822004e-03  -3.6250210e-02  -1.4439091e-02
+  -1.2654645e-02   3.4815893e-03   2.1409682e-03  -1.1047830e-02   8.5755488e-02
+   1.8052831e-03  -3.6731514e-03   1.8678683e-03  -2.5879065e-02  -5.3538462e-02
+  -1.5420664e-03   1.5311111e-03   1.0955226e-05   2.3287122e-03   1.3705604e-02
+  -1.5653990e-02   8.3839309e-03  -2.3211149e-02  -1.3328790e-02   8.2988125e-02
+  -1.7423562e-02   7.4416608e-03  -2.0499307e-02  -1.7402886e-02  -2.2022631e-02
+  -1.3702655e-02   5.6135221e-03  -2.2392075e-02  -1.7539962e-03   6.9014882e-02
+   3.9346238e-03  -2.5181347e-03  -1.4164891e-03   2.9846952e-03  -2.8312270e-02
+   8.4377328e-04  -1.7736340e-03   9.2986068e-04  -2.1446756e-03  -1.0515071e-03
+  -4.8219602e-03   2.3440050e-02  -4.0881332e-02   9.2754381e-02   1.1578372e-01
+  -2.2470093e-03   3.4849935e-02  -5.4866168e-02   8.7187096e-02   1.1541765e-01
+  -1.0598283e-02   2.3265996e-02  -3.4930955e-02   8.3179860e-02   9.4842989e-02
+   5.6459338e-03   2.1789985e-04  -5.8638337e-03   5.8240634e-03   1.5135250e-02
+  -1.8698418e-03   8.3094254e-04   1.0388992e-03  -5.4898300e-03  -1.2217423e-02
+  -5.6453389e-03   8.3593506e-03  -3.2754459e-02  -1.3744421e-02   1.9181603e-01
+  -1.9648300e-02   1.7927859e-02  -2.8320006e-02  -4.5832308e-02   1.1794710e-01
+  -2.2158587e-02   1.4969445e-02  -2.2851306e-02  -1.7837594e-02   1.3772559e-01
+  -5.8585358e-03   6.4808885e-05   5.7937269e-03  -1.8307098e-02  -4.2421959e-02
+   8.0859578e-05   5.5196143e-04  -6.3282101e-04   5.8991544e-03   2.3964472e-02
+  -3.3768996e-03   3.4492905e-03  -3.4406502e-02   4.7933570e-02   1.1522000e-01
+   2.4122066e-03   4.1048095e-03  -4.0851127e-02   3.7221304e-02   3.4337664e-02
+  -1.3914698e-04   4.0768833e-03  -3.8271848e-02   6.8107215e-02   1.4088466e-01
+  -2.0636488e-03  -1.6469996e-03   3.7106485e-03  -1.7373233e-02  -2.4111279e-02
+   3.3421071e-04  -1.7734027e-03   1.4391920e-03  -4.6634974e-04   4.8035727e-03
+  -1.4848101e-02  -1.3094302e-02   2.0367005e-02   2.7416986e-02   2.3385178e-02
+  -1.2206973e-02  -2.8861056e-02   3.3492631e-02   2.1662943e-02   1.4169138e-01
+  -6.8560731e-03  -1.3154047e-02   1.2434722e-02   3.5420987e-02   7.8198093e-02
+  -9.9228976e-04   6.7348765e-03  -5.7425867e-03  -4.8134825e-03  -9.9625018e-03
+   1.4377660e-03  -2.5654347e-03   1.1276687e-03   8.4740045e-04  -1.5614459e-02
+  -1.8829320e-02   1.0504848e-02  -1.8167623e-02   1.4257823e-02   6.9079683e-02
+  -1.6540282e-02   6.2763660e-03  -1.6228179e-02  -6.9168572e-03  -2.5380874e-02
+  -1.9785646e-02   8.3716812e-03  -1.5078130e-02   4.0405504e-02   1.3460000e-01
+   2.7223640e-03  -5.9549990e-03   3.2326350e-03   1.5011627e-02  -3.5607448e-02
+  -7.7482324e-04   1.8677014e-03  -1.0928782e-03  -7.8804967e-03  -5.0095780e-04
+  -3.1105362e-01   1.6375373e-01  -3.3227462e-01   6.2654422e-01   3.4116356e+00
+  -1.1305977e-02  -2.0656696e-02   9.4777522e-02   9.6522060e-02  -8.5881193e-02
+  -2.1535933e-02  -1.1286801e-02   9.5637583e-02   1.0569246e-01  -2.2440309e-02
+  -2.0737388e-02  -1.8024658e-02   1.0157689e-01   7.7576351e-02  -1.4999265e-01
+  -1.6046844e-03   5.1783983e-03  -3.5737139e-03  -6.5167040e-03  -1.6834984e-02
+   9.8036821e-04  -1.5631151e-04  -8.2405669e-04  -1.2663358e-04   6.4851551e-04
+  -6.4947884e-03  -1.8224757e-02   8.7036146e-02  -1.0261865e-01  -2.2877791e-01
+  -9.8210861e-03  -1.0037916e-02   8.2175602e-02  -8.0501656e-02  -1.7565723e-01
+  -1.3868200e-02  -1.8746209e-02   9.4931009e-02  -1.0002124e-01  -2.2424346e-01
+   4.9616530e-04   2.0894729e-03  -2.5856382e-03   3.6591091e-02   6.8765564e-02
+  -1.3644953e-03  -7.0488584e-05   1.4349839e-03  -6.8052797e-03  -2.9364506e-02
+  -1.7557413e-02  -4.1905366e-02   1.6858131e-01  -1.4183693e-01  -2.8209775e-01
+  -2.0555770e-02  -3.9181205e-02   1.6885550e-01  -1.5756098e-01  -3.5719710e-01
+  -2.7275712e-02  -4.6656849e-02   1.8305109e-01  -1.5673449e-01  -3.7565759e-01
+  -5.7672220e-03   3.1522385e-03   2.6149835e-03  -9.6084147e-03   2.7182651e-02
+   1.2879184e-03  -5.0603125e-04  -7.8188711e-04   4.3353035e-03  -9.0305571e-03
+  -3.8221876e-03  -1.4198808e-02   8.0831616e-02  -9.7487234e-02  -2.4901680e-01
+  -1.2445157e-02  -2.7246233e-02   1.0250201e-01  -8.4964795e-02  -1.8606340e-01
+  -7.7349763e-03  -2.5944843e-02   9.6490439e-02  -7.9354635e-02  -2.0718782e-01
+  -3.4993689e-04   1.5118799e-03  -1.1619430e-03  -1.7006462e-03   4.3275274e-02
+  -1.5741295e-03  -1.7369698e-03   3.3110993e-03   1.3374976e-02   1.5555642e-02
+  -2.6206359e-02  -3.2148782e-02   1.3419595e-01  -6.0961581e-02  -2.9993017e-01
+  -3.5658839e-02  -1.4526901e-02   1.2602655e-01  -4.9075004e-02  -2.4547360e-01
+  -3.5586755e-02  -3.3884041e-02   1.4531160e-01  -7.9921218e-02  -3.3185588e-01
+  -2.1674351e-03   2.7938613e-03  -6.2642619e-04  -5.1944872e-03   4.1380507e-02
+   2.3108084e-03  -1.0973173e-03  -1.2134911e-03   2.3882718e-03  -6.1557935e-03
+  -7.0539074e-03  -2.4880467e-02   9.1067781e-02  -2.4343976e-02  -2.3017454e-01
+  -2.2906113e-02  -1.1319307e-02   9.3358827e-02  -2.1584235e-03  -1.7573800e-01
+  -2.3702900e-02  -2.2280180e-02   1.0511649e-01  -4.4255768e-02  -2.4649351e-01
+   1.8213517e-03  -1.8665207e-03   4.5168994e-05   1.9733430e-02   2.1213813e-02
+  -1.6854212e-03  -1.1997432e-03   2.8851644e-03  -8.9129004e-03  -1.3439925e-02
+   1.1638540e-02  -1.0660235e-02   4.2723280e-02  -6.6589347e-02  -9.5886588e-02
+   2.0959906e-02  -1.8384295e-02   4.1125973e-02  -6.7218723e-02  -1.3768997e-01
+   2.2984561e-02  -1.2138527e-02   3.2855550e-02  -6.8304297e-02  -1.0283661e-01
+  -2.7780344e-03  -1.9365711e-03   4.7146055e-03  -6.4585741e-03  -1.0956930e-02
+   2.2847027e-03   1.6180713e-03  -3.9027740e-03  -4.1939408e-03  -9.2986437e-03
+  -5.3409715e-03  -1.2113538e-02   7.8195083e-02  -2.4675687e-02  -1.6966287e-01
+   8.5085651e-04  -1.1678488e-02   7.1568206e-02  -3.0597789e-02  -1.8205644e-01
+  -2.1740238e-04  -1.2763862e-02   7.3721839e-02  -3.4064324e-02  -1.4547134e-01
+   5.3104315e-03   5.7092869e-03  -1.1019718e-02  -8.0044162e-03  -4.2402176e-02
+  -1.8058215e-03   2.8664131e-04   1.5191802e-03  -3.8915188e-03   8.9325667e-04
+   1.0367530e-03  -3.4640337e-03   4.7429871e-02   2.2095607e-02  -1.2502320e-01
+  -3.2171315e-03   1.3220725e-02   3.4998997e-02   2.0821026e-02  -1.4310608e-01
+  -1.5575008e-03  -6.9861579e-03   5.3546249e-02   1.2924543e-02  -1.4952460e-01
+   1.1500723e-03   6.8407493e-04  -1.8341472e-03   9.3917826e-03   8.9855603e-03
+  -8.2698528e-04  -2.3632969e-06   8.2934858e-04  -6.9186386e-03  -6.1936706e-03
+  -9.8297966e-03  -1.9133639e-02   7.2220758e-02  -6.9185650e-02  -1.9815551e-01
+  -1.1232786e-02   6.1033107e-03   4.8386797e-02  -4.3209960e-02  -1.9849400e-01
+  -1.1306461e-02  -1.6795987e-02   7.1359769e-02  -6.0995370e-02  -1.7329898e-01
+  -4.3632303e-04  -3.5330645e-03   3.9693875e-03   4.8699889e-03   6.1989416e-02
+   1.1151271e-03  -5.9044581e-04  -5.2468131e-04   7.7025800e-03  -5.2847901e-03
+  -6.8845486e-03  -3.0670243e-02   9.3499426e-02  -6.4919674e-02  -2.4074126e-01
+  -2.6656286e-02  -1.5017015e-02   9.7617936e-02  -7.2063994e-02  -2.5942565e-01
+  -1.9635213e-02  -2.1933917e-02   9.7513764e-02  -6.9020042e-02  -2.6303624e-01
+  -4.0326939e-03   6.6271510e-03  -2.5944571e-03  -2.3678612e-02  -2.0571062e-02
+   1.4800357e-03  -1.5954921e-03   1.1545647e-04   2.3653726e-03  -6.2574676e-03
+  -8.8612258e-03  -2.4856704e-02   8.8722442e-02  -2.3069563e-02  -1.3192328e-01
+  -2.3553753e-02  -1.5599961e-02   9.4158227e-02   1.3964329e-02  -6.8084108e-02
+  -1.8260373e-02  -1.9973079e-02   9.3237965e-02  -2.7204733e-02  -1.2881827e-01
+   1.9249495e-05   8.8250281e-04  -9.0175231e-04  -9.7735196e-04   2.2023716e-02
+  -9.0255593e-04  -5.3578386e-04   1.4383398e-03  -1.5263977e-03  -1.2256325e-02
+  -2.7264794e-02  -4.6774285e-02   1.5450184e-01  -4.7668882e-02  -3.3568392e-01
+  -4.5188671e-02  -3.5770083e-02   1.6142152e-01  -1.1436326e-02  -2.6488022e-01
+  -4.0358431e-02  -4.4425021e-02   1.6524622e-01  -6.0406386e-02  -3.4997397e-01
+   1.2866985e-03  -4.4638039e-03   3.1771054e-03  -8.7605938e-03  -4.6420612e-02
+  -8.1486621e-04   8.6181022e-04  -4.6944004e-05   6.2704443e-04  -3.0928741e-03
+   7.8276458e-03  -1.5062558e-02   4.9673895e-02  -1.0228114e-01  -2.5464106e-01
+   4.7863096e-03  -9.2788074e-03   4.6931481e-02  -1.1688261e-01  -3.7054911e-01
+   3.5487841e-03  -1.5047313e-02   5.3937512e-02  -1.1199017e-01  -2.7519596e-01
+  -2.4870042e-03  -4.2353975e-03   6.7224017e-03  -7.3162708e-03   3.2029612e-02
+   5.1601512e-04   7.2474487e-04  -1.2407600e-03  -4.4390622e-03  -3.0335530e-02
+  -6.7869322e-03  -2.7936297e-02   1.1989195e-01  -1.1363246e-01  -4.1780008e-01
+  -5.3919057e-03  -2.2678805e-02   1.1323943e-01  -1.1743810e-01  -5.2978256e-01
+  -2.9458610e-03  -2.9238861e-02   1.1735344e-01  -9.6096320e-02  -3.8062639e-01
+   2.5198475e-03  -4.2282957e-03   1.7084482e-03   1.8339433e-02   3.2870613e-02
+   1.1162605e-03   2.5119842e-03  -3.6282447e-03  -7.6973603e-03  -7.6025440e-03
+  -2.6497949e-02  -2.5000611e-02   1.0522750e-01  -2.5798548e-02  -1.8108741e-01
+  -2.5191771e-02  -7.6639250e-03   8.6584636e-02  -5.6895373e-02  -1.7802645e-01
+  -2.8474445e-02  -2.7189408e-02   1.0939279e-01  -4.9915021e-02  -2.0854252e-01
+   1.4532491e-03   3.1334022e-03  -4.5866513e-03  -1.2242773e-02  -3.3438441e-02
+  -1.9519685e-03  -1.1925812e-03   3.1445498e-03   2.1217625e-03  -2.3714911e-03
+  -1.4409934e-02  -2.0465730e-02   7.3491707e-02  -6.5929371e-02  -3.9633886e-02
+  -3.4456988e-02  -9.7353569e-03   8.2808387e-02  -7.3004583e-02  -6.0258320e-03
+  -4.0440263e-02  -1.4048717e-02   9.3105024e-02  -4.8014482e-02  -3.9216132e-02
+  -1.0755112e-03  -9.4904937e-04   2.0245605e-03  -3.1138610e-03   1.9757390e-02
+  -1.7469302e-03   7.5194473e-04   9.9498547e-04   3.1961152e-03  -8.1765908e-03
+   6.4218601e-04  -1.1368109e-02   7.4880859e-02  -4.5970744e-02  -2.3625663e-01
+   5.4423549e-03  -1.0490875e-02   6.9203456e-02  -7.5653489e-02  -3.5994528e-01
+  -1.3522219e-03  -1.5773066e-02   8.1280224e-02  -2.3539700e-02  -2.2471840e-01
+  -9.6610164e-04   1.1130518e-03  -1.4695014e-04  -8.2179107e-03  -1.1433519e-02
+   1.5157714e-03   1.3053126e-04  -1.6463027e-03   7.6843907e-03   4.2488260e-03
+   6.9724488e-03  -8.1522207e-03   4.0161141e-02  -2.8110481e-02  -1.7591905e-01
+   1.2938033e-03  -1.3224851e-02   5.0912417e-02  -1.2880028e-02  -6.1324562e-02
+   6.3383767e-03  -5.5711789e-03   3.8214171e-02   5.7367330e-03  -1.1893433e-01
+  -3.2109759e-03   6.6468284e-04   2.5462930e-03  -1.6558799e-02  -1.0405200e-02
+   2.5638476e-03  -2.4841810e-03  -7.9666545e-05   7.2797002e-03  -1.2346304e-02
+  -1.2656828e-02  -2.9529961e-02   1.3310369e-01  -9.6048946e-02  -2.7645850e-01
+  -5.1273017e-03  -3.8277606e-02   1.3432180e-01  -1.2788578e-01  -3.4432864e-01
+  -2.1845091e-03  -3.0962522e-02   1.2406393e-01  -9.9187903e-02  -2.2524076e-01
+   2.7633778e-03  -1.0406376e-03  -1.7227402e-03  -2.6923913e-04  -4.8103468e-02
+  -1.7996370e-03   5.2460517e-04   1.2750318e-03   3.1451140e-03   1.3811766e-02
+  -3.2340365e-01  -5.1676643e-01   2.0703248e+00  -1.0948270e+00  -4.5287434e+00
+   4.7392182e-02   1.9327007e-02  -7.5373386e-02   3.7896187e-02   2.3804991e-02
+   8.8880409e-03   4.8292095e-02  -6.5834332e-02   6.0751638e-02   1.1317149e-01
+   7.0703440e-03   1.9445338e-02  -3.5169878e-02   4.7346695e-02   5.5207581e-02
+  -3.8036791e-03   7.4467654e-03  -3.6430864e-03   4.8005484e-02   2.4408791e-03
+   1.2158132e-03  -2.8714165e-03   1.6556033e-03   5.2249608e-03   7.5443260e-02
+   4.0388391e-02   7.4659787e-03  -5.1773147e-02  -1.5510779e-02  -2.2431980e-02
+   2.3970806e-02   3.0718866e-02  -5.8608449e-02   1.5427113e-02   6.5463346e-02
+   1.7038692e-02   8.0392205e-03  -2.8996690e-02  -1.0474764e-02  -2.9942948e-02
+  -4.7791178e-04   3.7854202e-04   9.9369755e-05   7.3920901e-02   4.4143702e-02
+  -9.9265657e-05   3.5149114e-04  -2.5222549e-04   4.0571547e-03   4.8527401e-02
+   7.1285251e-02   2.0787480e-02  -9.7341656e-02  -3.1718800e-02   8.5605052e-02
+   5.1568370e-02   4.6510253e-02  -1.0334755e-01  -4.8970396e-02  -6.8949230e-03
+   4.2901072e-02   1.4901153e-02  -6.3071151e-02  -6.5145447e-02  -1.6251214e-02
+   1.6579485e-03   4.6493471e-03  -6.3072956e-03   3.7679091e-02  -3.0844313e-02
+  -8.2500422e-04  -1.1322891e-03   1.9572933e-03  -5.9056433e-04   5.1540674e-02
+   5.1238693e-02   2.1437155e-02  -8.5211455e-02  -9.1713358e-02  -2.5689286e-02
+   1.4251434e-02   4.1377658e-02  -6.8164700e-02  -9.8818391e-02  -3.6443494e-02
+   1.9159590e-02   1.6634985e-02  -4.8330182e-02  -6.7730205e-02  -1.5196768e-02
+  -5.1921191e-03   2.6350671e-03   2.5570521e-03   4.8520398e-02   1.2962462e-02
+   1.5203757e-03  -1.2660214e-03  -2.5435437e-04   5.1576302e-03   5.3385901e-02
+   4.5427898e-02   1.2984115e-02  -6.6643068e-02   1.1833499e-02  -1.3509353e-02
+   4.7332294e-03   4.9078147e-02  -6.2042431e-02   4.8682733e-02   1.1773865e-01
+   3.0234432e-03   1.0202723e-02  -2.1457220e-02   1.4834725e-02   1.8584716e-02
+  -5.2916563e-03   2.4887880e-04   5.0427775e-03   4.9536879e-02   2.1577993e-02
+   3.2275327e-03   1.2530620e-04  -3.3528389e-03   6.8278379e-03   5.6220850e-02
+   4.1951021e-02   1.5064401e-02  -7.4039584e-02  -8.1816700e-02   8.3691151e-02
+   4.6722742e-03   5.1062810e-02  -7.2759246e-02  -4.5483722e-02   1.6352703e-01
+   7.7043661e-04   2.0909997e-02  -3.8704595e-02  -7.7165418e-02   1.1621520e-01
+  -2.6443296e-03   2.7835064e-03  -1.3917683e-04   3.9843025e-02   1.1954619e-02
+   1.5601586e-03  -1.2659999e-03  -2.9415880e-04   1.1476988e-03   3.1058626e-02
+   4.9145764e-02   1.0038437e-02  -6.0419754e-02   9.2028954e-02  -9.8224072e-02
+   5.3088441e-02   2.5814759e-02  -8.0138753e-02   9.6144650e-02  -1.1411157e-01
+   5.3154065e-02   1.1016778e-02  -6.5406397e-02   1.1373768e-01  -4.6781317e-02
+   8.7886128e-04  -1.6509078e-03   7.7204648e-04   4.4530688e-02  -2.5620815e-02
+   7.3876498e-04  -7.3182712e-04  -6.9378553e-06   3.9650174e-03   5.8539095e-02
+   3.8445152e-02   1.0785513e-02  -5.2070596e-02  -1.8402526e-02  -4.6416211e-02
+   3.1198244e-02   2.9397556e-02  -6.3435731e-02  -6.3145434e-02  -1.5374845e-01
+   2.9878428e-02   1.3054166e-02  -4.5772526e-02  -3.2456967e-02  -4.7623024e-02
+  -2.7707751e-03   2.8215738e-03  -5.0798765e-05   6.2832526e-02  -8.0017179e-03
+   8.3746871e-04  -2.3243751e-03   1.4869064e-03  -4.0074823e-03   5.8774686e-02
+   4.0309922e-02   1.5435164e-02  -5.9169922e-02   1.0940804e-01   9.1502209e-02
+   1.8199194e-02   3.4565741e-02  -5.6189770e-02   8.2954970e-02   6.6799389e-02
+   2.4410280e-02   7.9679996e-03  -3.5803114e-02   9.5397588e-02   8.5401848e-02
+  -6.2880702e-04   6.1566973e-03  -5.5278903e-03   6.3631903e-02  -8.7371249e-03
+   1.2214296e-03  -2.5248490e-03   1.3034194e-03  -9.9804899e-03   4.7082368e-02
+   3.5154313e-02   7.0133017e-03  -4.9439898e-02   2.0542868e-02   7.6134531e-03
+   7.9167268e-03   5.0555701e-02  -6.5744711e-02  -6.0656556e-03  -1.1665586e-02
+   6.1154765e-03   1.0494146e-02  -2.3881906e-02  -2.7398839e-03  -1.3989488e-02
+   2.0320733e-03  -1.1353399e-03  -8.9673338e-04   4.4757035e-02  -6.5072023e-03
+   8.9423616e-04   6.1637822e-04  -1.5106144e-03   5.8971033e-03   7.7517108e-02
+   5.0977697e-02   1.4722804e-02  -9.1335167e-02   3.3440493e-02   1.0241315e-01
+   1.4828856e-02   4.0727433e-02  -8.1190954e-02   4.4519434e-02   1.5003608e-01
+   1.8500116e-02   1.7502306e-02  -6.1637087e-02   2.2829699e-02   1.1335277e-01
+  -1.2503047e-04   5.2868063e-03  -5.1617758e-03   3.1298074e-02  -5.3505857e-02
+   1.5401774e-04  -1.6315022e-04   9.1324712e-06   2.3117832e-03   5.7351376e-02
+   4.2237966e-02   7.0268554e-03  -6.7980672e-02   7.8757524e-03   7.1402444e-02
+   4.3318974e-03   4.6058594e-02  -6.9106342e-02   2.5002917e-02   9.1485950e-02
+   5.5169101e-03   1.3027290e-02  -3.7260051e-02   7.7612158e-03   8.4768389e-02
+   3.9909077e-04  -5.0821451e-04   1.0912374e-04   5.6221296e-02  -9.2524205e-03
+   7.9728950e-04   2.0142306e-03  -2.8115201e-03  -2.3217632e-04   5.8874751e-02
+   6.3463064e-02   1.2961264e-02  -9.3674366e-02   1.9172120e-02   5.8584041e-02
+   3.4899998e-02   3.9938058e-02  -9.2088095e-02   2.1062160e-02   4.3603084e-02
+   3.5973076e-02   1.6058835e-02  -6.9281949e-02   9.7039538e-03  -2.2248849e-02
+  -2.7403538e-03   3.2576483e-03  -5.1729454e-04   4.1508936e-02  -5.3823415e-02
+  -1.7262773e-04  -8.0576511e-04   9.7839285e-04  -4.0441290e-04   6.9283925e-02
+   3.8297181e-02   8.9338449e-03  -6.6182453e-02   1.0742351e-02   6.6721903e-02
+   1.5646253e-02   2.9351661e-02  -6.3949341e-02  -1.9881011e-03   3.7069222e-02
+   1.3897375e-02   6.0109666e-03  -3.8859768e-02   1.3338027e-02   1.0288752e-01
+  -1.8720023e-03   4.7798421e-03  -2.9078399e-03   6.1033535e-02   3.1212286e-02
+  -1.7950453e-04  -2.1904562e-03   2.3699607e-03  -2.6374416e-03   3.9942648e-02
+   6.7343648e-02   1.4132334e-02  -8.9250185e-02   3.8361971e-02  -8.2585814e-02
+   4.9768109e-02   5.2090800e-02  -1.0963311e-01   6.7297345e-02  -1.1557195e-01
+   5.0170878e-02   1.0113944e-02  -6.8059025e-02   5.0737646e-02  -2.4300603e-02
+   2.1377053e-04  -2.0304522e-04  -1.0725314e-05   5.5246074e-02   1.3481586e-02
+   8.8169264e-04  -4.5331425e-05  -8.3636122e-04   1.3991437e-02   7.1386725e-02
+   2.9266472e-02   1.1416418e-02  -3.2491536e-02  -4.9874284e-03  -1.8360071e-02
+   3.8698531e-03   3.5906492e-02  -3.1584992e-02  -2.1027236e-02  -2.5274922e-02
+  -6.1875712e-03  -6.9970262e-04   1.5078627e-02  -1.7004395e-02  -1.9848412e-02
+   5.3820702e-04   3.7117779e-03  -4.2499849e-03   3.9159932e-02  -4.5506759e-02
+  -6.3000870e-04  -8.3861880e-04   1.4686275e-03   4.2297619e-03   7.8367616e-02
+   3.6859947e-02   1.1207708e-02  -4.4880370e-02  -2.0926547e-03   7.5100948e-02
+   7.7245462e-03   4.1720496e-02  -4.6257758e-02  -3.5404075e-02   2.9330166e-02
+   2.9747538e-03   6.6890563e-03  -6.4765255e-03  -1.0840429e-02   4.0657139e-02
+   2.6294845e-04  -4.2276274e-03   3.9646790e-03   5.4114464e-02  -4.5279716e-02
+  -8.4491293e-04   2.1149886e-03  -1.2700756e-03  -6.8405236e-03   6.2642421e-02
+   4.2100445e-02   1.6209002e-02  -5.2031322e-02   2.7662236e-02  -5.8909092e-02
+   3.9195927e-02   1.9044638e-02  -5.1962440e-02  -2.9045016e-03  -2.2326097e-01
+   3.2486634e-02   1.1998316e-02  -3.8206825e-02   3.0966215e-02  -1.6438878e-01
+  -2.8185054e-03  -4.6502643e-03   7.4687696e-03   3.8923897e-02  -3.6028916e-02
+   1.0648828e-03   1.0125125e-03  -2.0773954e-03   4.5485456e-03   7.7306780e-02
+   3.9060617e-02   1.8196632e-02  -6.5658706e-02   9.6442043e-02   1.3773963e-01
+   7.9069829e-03   2.8171303e-02  -4.4479743e-02   1.3830752e-01   2.9545508e-01
+   7.0878600e-03   1.7663750e-02  -3.3153067e-02   1.2936315e-01   1.6478762e-01
+   5.4795597e-03  -8.4396342e-03   2.9600745e-03   6.2117126e-02  -8.4341954e-04
+  -2.3594868e-04   1.0791929e-03  -8.4324424e-04  -6.6241806e-03   3.8639426e-02
+   6.5592273e-02   2.2972632e-02  -9.9011290e-02  -4.9840566e-02  -8.3335452e-02
+   4.0869867e-02   3.6685401e-02  -8.8001652e-02  -7.7304578e-02  -1.9362666e-01
+   4.9587262e-02   2.2166244e-02  -8.2199890e-02  -2.1767639e-02  -4.7910337e-03
+   3.1107342e-03  -2.6074981e-03  -5.0323614e-04   2.8753988e-02  -5.9110057e-02
+  -1.4017867e-03   8.0450829e-04   5.9727841e-04   5.7406707e-03   8.4781389e-02
+   9.2186170e-03  -7.4134539e-02   2.3232885e-02   6.5284619e-02   1.3349465e-02
+   5.5126570e-03   1.8367195e-02  -2.2898441e-02   7.6518114e-02   2.5219092e-01
+  -1.1582455e-04   2.1366105e-02  -2.0268870e-02   6.6152547e-02   3.2310647e-01
+  -2.8768074e-03   1.7248832e-02  -1.3390614e-02   6.3480751e-02   2.7705858e-01
+   2.6206379e-03   3.0654889e-03  -5.6861268e-03  -1.7276235e-02  -2.5665712e-02
+  -1.5424401e-04  -8.2848324e-04   9.8272725e-04   4.4003361e-03   1.0018948e-02
+   8.9278114e-03   1.9185515e-02  -3.5842190e-02   7.9934993e-02   2.3538987e-01
+   1.0435296e-02   2.7913074e-02  -4.6077234e-02   9.2751689e-02   3.4194219e-01
+   2.7255024e-03   2.2012824e-02  -3.2467190e-02   7.0637236e-02   2.3523865e-01
+   1.7041693e-03   3.3575699e-03  -5.0617392e-03   4.1170231e-03   4.3418188e-02
+   8.0241432e-04  -1.7895924e-03   9.8717810e-04   1.7872027e-04  -2.5723139e-02
+   1.7497732e-03   2.5649242e-02  -1.7397740e-02   5.4739628e-02   3.3768554e-01
+   5.9270943e-04   2.6256436e-02  -1.6847870e-02   3.0760707e-02   2.5601998e-01
+  -8.0564205e-03   2.0338990e-02  -2.2812942e-03   3.6139241e-02   2.8948220e-01
+   3.1653116e-03  -2.5597787e-03  -6.0553287e-04   1.2210329e-03  -4.7494849e-02
+   6.8238561e-04   1.5089096e-03  -2.1912952e-03  -9.4598790e-03   1.6637574e-03
+   4.0750160e-03   1.4145864e-02  -2.5917087e-02   4.0668637e-02   5.2447265e-02
+  -7.4379184e-03   1.9094543e-02  -1.9352831e-02   3.4539822e-02   5.2359212e-02
+   6.8763373e-04   1.9363927e-02  -2.7747768e-02   4.0459739e-02   6.3722600e-02
+  -1.7677456e-03   1.6949525e-03   7.2793122e-05   1.1319114e-02   3.5920151e-02
+  -1.1309031e-04  -7.9151478e-04   9.0460509e-04  -9.3650594e-03  -3.3208469e-02
+  -7.5820309e-03   1.8023606e-02  -2.2704940e-02   5.7864263e-02   1.9458121e-01
+  -2.5776418e-02   2.5853085e-02  -1.2340032e-02   7.1155688e-02   2.5812886e-01
+  -2.7511413e-02   2.1163262e-02  -5.9152147e-03   6.3440963e-02   2.0413677e-01
+  -6.0314937e-03   2.3632435e-03   3.6682501e-03  -1.0262519e-02   2.0444577e-02
+   2.6685550e-03  -1.3989570e-03  -1.2695980e-03   6.5361136e-03  -9.0091560e-04
+  -1.7607548e-02   9.1045217e-03  -2.2846670e-03   1.3427428e-03   1.5912011e-01
+  -3.3396003e-02   3.6275176e-02  -1.3666866e-02   5.6725975e-02   2.7494922e-01
+  -2.6340499e-02   1.1606738e-02   3.9460676e-03   4.2401052e-02   2.5191481e-01
+  -3.6161412e-03  -5.8107696e-04   4.1972182e-03   3.9846321e-03   3.2590015e-02
+   1.7648981e-03   4.4543655e-04  -2.2103346e-03  -2.0153271e-03  -1.7794833e-02
+   3.1553469e-03   2.2902159e-02  -2.4472479e-02  -4.2275067e-03   4.3583718e-02
+   1.7219680e-02   1.9644728e-02  -3.5279380e-02   4.2241108e-03   8.7667110e-02
+   2.0507418e-02   1.7688865e-02  -3.6611256e-02   3.1529652e-02   1.0360216e-01
+  -3.8173392e-03   1.6201307e-03   2.1972085e-03  -3.9770889e-03   5.0291175e-02
+   1.5550054e-03   6.4833854e-05  -1.6198393e-03  -2.8808454e-04  -3.5817554e-02
+   1.5258318e-02   1.4876141e-02  -2.8542960e-02  -6.2022645e-02   1.5400578e-01
+   2.9933120e-02   1.7551979e-02  -4.5893599e-02  -1.0918918e-01   6.2882789e-02
+   2.7148455e-02   2.4109491e-02  -4.9666446e-02  -7.7650138e-02   1.3681893e-01
+   7.0582644e-05   8.4385770e-04  -9.1444034e-04   1.8670945e-02   2.3289894e-03
+   8.7204217e-04  -8.5664415e-04  -1.5398017e-05   3.4355514e-03   1.1951071e-02
+   9.8742061e-03   2.0932037e-02  -3.7693128e-02   1.3853133e-01   2.0354106e-01
+   1.8339541e-04   2.7702106e-02  -3.4772387e-02   1.3701024e-01   2.5511992e-01
+   7.0961399e-03   1.9933427e-02  -3.3916452e-02   1.3331748e-01   2.3113176e-01
+  -4.2889492e-03  -7.2371510e-03   1.1526100e-02  -8.8141458e-03  -4.3603774e-02
+  -3.4018497e-04   7.1249665e-04  -3.7231168e-04   9.2709211e-03   2.1847724e-02
+  -4.1607560e-03   5.8873027e-03  -4.5679944e-03   5.6746204e-02   1.4920393e-01
+  -7.4047660e-03   2.3890484e-02  -1.9327166e-02   7.5571634e-02   2.0654084e-01
+  -9.2368749e-03   1.1228754e-02  -4.8333263e-03   4.4156635e-02   1.1159730e-01
+   5.4717276e-03  -1.2907788e-03  -4.1809488e-03   7.4032363e-03   1.4415275e-02
+  -1.3104652e-03   7.8339754e-04   5.2706765e-04   2.8936703e-03  -1.0795508e-02
+  -1.7725275e-02   8.5822951e-03  -5.8188653e-03   8.4027824e-02   2.1805972e-01
+  -4.1210660e-02   3.3325007e-02  -7.0761927e-03   1.0200255e-01   2.6720470e-01
+  -3.2274081e-02   1.4255845e-02   3.0563903e-03   6.4139901e-02   2.2796842e-01
+  -1.8641311e-04   1.5657848e-03  -1.3793717e-03   2.7985462e-03  -2.8229936e-02
+   1.2525117e-03  -4.2578167e-04  -8.2673008e-04  -1.6851136e-03  -4.4035055e-03
+   4.3949456e-04   1.3274774e-02  -2.0799251e-02   5.5428099e-02   1.9740266e-01
+  -1.1603314e-02   2.6283178e-02  -2.1764845e-02   7.3902615e-02   1.4841097e-01
+  -9.6604656e-03   1.6091655e-02  -1.3516171e-02   5.0193682e-02   1.5513963e-01
+   1.7255757e-03   4.6928469e-03  -6.4184226e-03   2.0123881e-02   4.6315750e-02
+  -1.9033938e-03  -5.8709745e-04   2.4904913e-03  -1.3401307e-02  -4.4710660e-02
+  -5.0797641e-03   1.7848352e-02  -3.5096520e-02   2.1673911e-02   2.2985178e-01
+  -1.4619169e-02   2.0450239e-02  -2.8159002e-02   3.7148277e-02   2.4234134e-01
+  -1.2370343e-02   2.0778693e-02  -3.0736282e-02   3.5630791e-02   2.5505897e-01
+   2.9257507e-03   9.3037587e-03  -1.2229509e-02  -4.9300342e-03   3.6338321e-02
+  -1.7182801e-03  -1.4443910e-03   3.1626710e-03  -1.9511415e-03  -2.0915568e-02
+  -1.3445237e-02   1.0576018e-02   3.0265518e-03   1.0017103e-01   1.3286723e-01
+  -1.8340370e-02   1.6173693e-02   2.3240100e-03   1.0332966e-01   7.9960238e-02
+  -1.9021411e-02   1.5604676e-02   3.5740678e-03   9.0924697e-02   1.1363609e-01
+  -2.0595237e-03  -7.0267617e-04   2.7621998e-03   5.0784393e-03  -1.2004342e-02
+  -9.0589846e-04  -1.8257109e-04   1.0884696e-03  -4.6475668e-03  -2.0653223e-02
+   1.6919759e-02   2.2832740e-02  -4.6349914e-02  -5.1377073e-02   1.6237383e-01
+   1.7039303e-02   3.6949669e-02  -6.0586387e-02  -4.6164616e-02   8.7291589e-02
+   1.9460216e-02   2.7150081e-02  -5.3207712e-02  -3.4315705e-02   1.8457849e-01
+  -1.3073744e-03  -7.6357821e-04   2.0709526e-03   9.3484742e-04   2.7760642e-02
+  -8.3086841e-04  -2.8802759e-04   1.1188960e-03   2.4972596e-03   5.4073394e-03
+   3.6616903e-04   2.0667769e-02  -2.9063660e-02  -3.9608105e-03   1.9588932e-01
+  -7.7105411e-03   1.4593113e-02  -1.4912294e-02  -1.5859255e-03   2.1046737e-01
+  -1.5403134e-02   1.5270129e-02  -7.8967170e-03   2.3890355e-02   2.1647891e-01
+  -3.1370928e-03   5.1446817e-04   2.6226246e-03   1.5302311e-03  -2.0887558e-02
+   2.9268709e-04   1.4272808e-03  -1.7199679e-03  -1.9611207e-03   1.8561283e-02
+   4.4769072e-03   1.6691088e-02  -3.4119561e-02  -1.1422227e-02   1.9435701e-01
+  -8.1430540e-03   2.5420035e-02  -3.0228547e-02  -3.0704176e-02   1.9552159e-01
+  -7.9397673e-03   1.7330707e-02  -2.2342506e-02  -2.9548365e-02   1.3106348e-01
+  -1.4968077e-03   3.0449669e-03  -1.5481592e-03  -6.6993160e-03  -6.2221527e-03
+   1.1625599e-03  -9.6393340e-04  -1.9862647e-04   8.3151686e-03   5.4927021e-03
+   7.8089660e-03   1.9102069e-02  -1.9618110e-02   8.0411515e-04   1.7955739e-01
+   1.8164009e-02   7.7076657e-03  -1.8578750e-02  -2.7500406e-02   5.7051203e-02
+   1.3500465e-02   9.7336388e-03  -1.5941179e-02  -1.7525145e-03   1.4727146e-01
+   8.8725792e-04   5.4504077e-04  -1.4322987e-03  -1.2728195e-02   3.4733334e-03
+  -4.3004156e-04   9.6080346e-04  -5.3076190e-04   1.0352926e-02   2.0072601e-02
+  -5.2200613e-03   9.1809834e-03   2.6716262e-04  -6.1747690e-04   1.5835629e-01
+  -7.6873128e-03   1.0378951e-02   1.5364466e-03   4.1572527e-02   2.8307781e-01
+  -7.7059888e-03   1.5572518e-03   1.0376822e-02  -2.0063632e-03   1.5816652e-01
+  -5.0232304e-04  -2.6727591e-03   3.1750821e-03   3.3280776e-03   2.2672046e-02
+  -1.0327945e-03  -5.2890994e-05   1.0856854e-03  -6.6928392e-03  -2.1462054e-02
+  -7.0879076e-03   2.6525385e-02  -3.0008132e-02   4.5160528e-02   3.2697120e-01
+  -2.2548959e-02   2.3746618e-02  -1.1768314e-02   7.6516861e-02   2.7945031e-01
+  -1.9501968e-02   2.5067177e-02  -1.6135863e-02   7.2655281e-02   3.5455861e-01
+  -5.3777010e-04  -6.8058847e-04   1.2183586e-03  -1.6091887e-02   6.8561386e-03
+   2.0864182e-04  -1.2851914e-03   1.0765496e-03  -2.9133112e-03   1.0103086e-03
+  -2.1336405e-01   2.7186708e-01  -1.6339405e-01   7.1791573e-01   3.6043680e+00
+  -1.9230099e-02  -3.3341427e-02   8.8771915e-02  -8.4338989e-02  -2.5294415e-01
+  -3.7759625e-02  -3.3373421e-02   1.0733343e-01  -1.0210901e-01  -2.5071381e-01
+  -3.4779267e-02  -2.8465744e-02   9.9445400e-02  -9.1544618e-02  -2.3547907e-01
+  -7.9601953e-04  -1.3907742e-03   2.1867937e-03   1.4265278e-02   8.2712306e-03
+  -1.2220362e-03   2.6064808e-04   9.6138812e-04   1.4224447e-03   1.4455409e-02
+  -1.1941281e-02  -2.2001651e-02   7.1164772e-02  -6.9468485e-02  -1.8229825e-01
+  -3.8686539e-03  -1.4801180e-02   5.5891675e-02  -5.7532973e-02  -1.9731454e-02
+  -1.4497203e-02  -2.0177766e-02   7.1896808e-02  -6.6503686e-02  -1.4370539e-01
+   1.2535930e-03  -1.7554457e-03   5.0185273e-04  -3.9900133e-03   2.4535536e-04
+  -8.9785315e-04   7.5195219e-04   1.4590096e-04   3.0850450e-03   1.0280443e-02
+  -2.0784178e-02  -4.2399135e-02   1.2987913e-01   9.4210716e-03  -1.8439166e-01
+  -1.6742860e-02  -5.4734320e-02   1.3817299e-01  -1.9511777e-02  -3.0855679e-01
+  -2.1485632e-02  -4.7260047e-02   1.3544149e-01  -1.2262581e-02  -2.5550318e-01
+   8.0464364e-04   5.0642837e-04  -1.3110720e-03  -6.9189870e-03   4.9294483e-03
+   3.5822186e-04   2.4147872e-04  -5.9970057e-04  -4.0534218e-03   4.7491273e-03
+  -2.6651031e-02  -2.4093839e-02   7.1350640e-02  -3.6788139e-03  -2.1067632e-01
+  -3.5542076e-02  -1.6922519e-02   7.3070364e-02   1.4300353e-02  -1.9396165e-01
+  -2.7501273e-02  -2.1368340e-02   6.9475382e-02   2.0139520e-03  -1.8031238e-01
+  -2.2715326e-03  -3.2795318e-03   5.5510644e-03  -8.6692773e-03   1.0977434e-02
+   9.7434762e-04   2.3030897e-03  -3.2774373e-03   1.7339943e-03   8.3480309e-03
+  -1.8149315e-02  -3.2417433e-02   9.8937306e-02  -7.9314459e-02  -3.2337327e-01
+  -2.2672442e-02  -2.3405690e-02   9.4448690e-02  -5.6669272e-02  -1.8983647e-01
+  -2.5503630e-02  -2.3329050e-02   9.7203237e-02  -5.5497098e-02  -2.3123042e-01
+   7.7131839e-04   7.9847629e-04  -1.5697947e-03   1.0306286e-02  -3.0516884e-04
+   1.1268559e-03  -3.1635112e-04  -8.1050474e-04   1.1212908e-02   2.4108835e-02
+  -2.2434119e-02  -2.9678205e-02   1.0183567e-01  -8.2010098e-02  -3.1006870e-01
+  -3.7972120e-02  -2.8204224e-02   1.1589969e-01  -6.5714641e-02  -2.5786121e-01
+  -3.4406099e-02  -3.2280344e-02   1.1640979e-01  -7.7571164e-02  -2.9131498e-01
+  -1.6093708e-03  -4.9394491e-03   6.5488199e-03   2.4422437e-03   2.6073003e-03
+   9.2378191e-04   3.7182562e-03  -4.6420381e-03  -1.4390990e-03  -9.1849373e-06
+  -1.7822514e-02  -2.3664325e-02   7.2774980e-02  -1.0094493e-01  -3.4357244e-01
+  -1.2138868e-02  -2.6090856e-02   6.9517864e-02  -1.4615110e-01  -3.5661514e-01
+  -2.7453982e-03  -2.6576768e-02   6.0610306e-02  -1.0261779e-01  -2.9147822e-01
+   3.6278341e-03   1.0163346e-03  -4.6441687e-03  -8.6126380e-03   9.0140510e-03
+   1.1712728e-03  -1.6838945e-03   5.1262164e-04  -4.8005705e-04  -4.6519236e-03
+  -1.7674533e-02  -2.1030397e-02   5.5351409e-02  -1.0839410e-01  -2.3737823e-02
+  -1.3176546e-02  -8.9925834e-03   3.8815608e-02  -1.2002030e-01  -6.9445909e-02
+  -1.1355606e-02  -1.8095872e-02   4.6097957e-02  -1.0240570e-01  -3.6854622e-02
+   6.8030043e-03  -4.5177292e-04  -6.3512313e-03   4.6363162e-03  -3.5180302e-02
+  -1.6874433e-03  -3.0521349e-04   1.9926568e-03   1.5683801e-03   1.0953260e-02
+  -1.5138679e-02  -1.8859509e-02   5.9040311e-02   1.1865938e-02  -2.7567242e-02
+  -2.2548246e-02  -2.1911603e-02   6.9501971e-02   2.6883670e-02   4.4678882e-02
+  -2.0326040e-02  -2.3569050e-02   6.8937213e-02   1.3523217e-02  -6.8309105e-02
+  -1.9885088e-03  -8.2674940e-03   1.0256003e-02  -7.4650057e-03  -4.2384790e-02
+  -8.5395947e-04   3.0377073e-03  -2.1837478e-03   4.0295850e-03   3.5646018e-03
+  -5.3588999e-03  -2.4626320e-02   7.0323386e-02  -1.7579979e-03  -6.4170274e-02
+  -1.4497231e-02  -1.4123478e-02   6.8958876e-02   1.2452253e-02  -1.0120076e-01
+  -1.6689744e-02  -1.7753318e-02   7.4781229e-02  -3.3841349e-02  -1.1955201e-01
+   3.6957718e-03  -1.7637218e-04  -3.5193996e-03   2.9341782e-02   5.7998054e-02
+  -1.6661230e-03   3.5206330e-04   1.3140597e-03  -4.4226275e-03  -2.2644482e-02
+  -2.8614411e-02  -3.1720260e-02   1.1017314e-01  -2.6971861e-02  -2.7402477e-01
+  -5.0049266e-02  -1.3584883e-03   1.0124622e-01  -1.0447851e-02  -2.2659604e-01
+  -4.3961540e-02  -2.4908274e-02   1.1870828e-01  -5.7628209e-02  -2.9332897e-01
+   2.5860856e-03   4.8062499e-03  -7.3923355e-03  -1.9616730e-02  -5.2901309e-02
+  -1.0753651e-03  -1.4433991e-03   2.5187642e-03   3.0098622e-04  -1.3203473e-03
+  -1.9270910e-02  -3.4605487e-02   9.0113596e-02  -1.0848225e-01  -2.3319499e-01
+  -2.6933311e-02  -3.3457020e-02   9.6627530e-02  -1.0589346e-01  -2.6671524e-01
+  -2.8465764e-02  -2.9359605e-02   9.4062568e-02  -9.8082277e-02  -2.2232083e-01
+   1.4036415e-03  -2.0286542e-03   6.2501262e-04   3.4461843e-03  -2.4105035e-02
+  -2.4594250e-03   2.6799565e-04   2.1914293e-03   4.7341747e-03   1.0655426e-02
+  -2.4711158e-02  -3.4078039e-02   1.2574756e-01  -1.7598814e-01  -2.9485185e-01
+  -3.0356459e-02  -3.2867957e-02   1.3018277e-01  -1.6614243e-01  -2.7649695e-01
+  -2.4063306e-02  -3.9572590e-02   1.3059425e-01  -1.7115075e-01  -2.5755138e-01
+  -1.7182059e-03   2.3442939e-03  -6.2608800e-04   8.8664999e-03   2.0600303e-02
+  -5.2492593e-04   2.6284503e-04   2.6208091e-04  -1.3647626e-02  -2.0192901e-02
+  -1.1565106e-02  -2.7190235e-02   7.9899823e-02  -3.0920999e-02  -1.4964789e-01
+  -1.4855116e-02  -2.6313044e-02   8.2312642e-02  -1.1388681e-02  -1.3660633e-01
+  -1.5486090e-02  -2.2249545e-02   7.8880117e-02  -2.3869825e-02  -1.6672868e-01
+   3.9971319e-03  -1.1331229e-04  -3.8838196e-03  -2.1278887e-02  -4.8374014e-02
+  -9.8493710e-04   2.8112649e-04   7.0381061e-04  -3.3258710e-03  -1.4697370e-02
+  -2.2386243e-02  -3.8461373e-02   9.6483091e-02  -5.4959498e-02  -2.7796447e-01
+  -2.1800513e-02  -3.4568674e-02   9.2004662e-02  -8.0354556e-02  -3.9274489e-01
+  -2.2250496e-02  -3.1624067e-02   8.9510038e-02  -6.1132332e-02  -2.7963137e-01
+  -2.1660413e-04   3.2974708e-03  -3.0808667e-03  -2.2985039e-03   2.3898770e-02
+   5.8914458e-04  -7.4982026e-04   1.6067568e-04   7.1364754e-03   2.2435537e-02
+  -1.6599225e-02  -1.7844329e-02   6.8635806e-02   9.0863809e-02  -2.0944564e-01
+  -1.8769900e-02  -2.2884974e-02   7.5847125e-02   8.8660651e-02  -1.9422710e-01
+  -2.3263042e-02  -2.2403500e-02   7.9858794e-02   9.2065314e-02  -2.0189506e-01
+  -1.8529185e-03  -3.1413500e-03   4.9942686e-03   1.5635716e-03  -1.1559499e-02
+  -7.4210444e-04   3.3261221e-04   4.0949224e-04  -2.1379491e-03  -2.1565271e-03
+  -1.5152809e-02  -2.4799560e-02   6.8973443e-02  -8.1314316e-02  -6.1204261e-02
+  -2.3498291e-02  -2.0798818e-02   7.3318184e-02  -7.7155571e-02  -3.4442312e-02
+  -2.1427693e-02  -1.9169869e-02   6.9618637e-02  -7.5422686e-02  -1.1855854e-01
+   1.6961258e-03   2.5425147e-03  -4.2386405e-03   1.7717285e-02   3.1258542e-02
+  -8.9882009e-04  -7.5600359e-04   1.6548237e-03  -3.9831771e-03  -1.0011852e-02
+  -8.0569184e-03  -2.8574045e-02   6.8308836e-02  -1.0319126e-01  -2.7874051e-01
+  -5.0381985e-03  -3.1919598e-02   6.8635669e-02  -1.0977432e-01  -3.0203123e-01
+  -8.2535737e-03  -3.2893143e-02   7.2824590e-02  -8.5707083e-02  -2.7416233e-01
+   3.2774180e-03   2.1996702e-03  -5.4770882e-03  -9.4752941e-03   5.1699045e-03
+  -9.0792365e-05  -1.8578205e-03   1.9486128e-03   1.1868621e-02   1.7848257e-02
+  -1.7150546e-02  -2.1340331e-02   6.2644106e-02  -4.0036198e-02  -1.4665451e-01
+  -1.9022370e-02  -2.5237850e-02   6.8413450e-02  -2.8482264e-02  -3.5708439e-02
+  -1.4386125e-02  -2.8104660e-02   6.6644014e-02  -5.0897754e-02  -1.2869958e-01
+   2.8734792e-03  -2.2051050e-03  -6.6837416e-04   1.4380568e-02   4.6830065e-02
+  -9.7213112e-04   1.8229104e-03  -8.5077932e-04  -2.1721337e-03  -2.2508121e-02
+  -2.6740980e-02  -3.4757793e-02   1.3120493e-01   2.4423945e-02  -2.6829107e-01
+  -3.3180633e-02  -3.0571306e-02   1.3345809e-01   2.0202196e-02  -3.7377083e-01
+  -3.1910765e-02  -3.7771108e-02   1.3938803e-01   1.7198775e-02  -2.6756291e-01
+  -3.5182537e-03   2.5171136e-04   3.2665424e-03  -1.4173557e-02  -3.3937746e-02
+   6.1024791e-04  -1.6081763e-03   9.9792835e-04  -6.7789695e-03  -5.6169686e-04
+  -4.1453971e-01  -5.3894142e-01   1.7441783e+00  -9.9580957e-01  -4.0073450e+00
+   1.8401543e-02   1.5055426e-02  -5.6689781e-02   3.4221995e-02   1.6171066e-01
+   4.7175764e-03   2.3700806e-02  -5.1651195e-02   3.6291074e-02   1.7144899e-01
+   1.3139574e-02   2.0942747e-02  -5.7315134e-02   5.4911722e-02   1.5128566e-01
+  -1.1369238e-03  -3.9297701e-03   5.0666939e-03   1.8734732e-03  -2.6895160e-02
+   7.7357096e-04  -2.5808174e-04  -5.1548921e-04   4.4764570e-03   3.4036515e-02
+   1.6872386e-02   1.1345686e-02  -3.4017773e-02   5.9223514e-02   1.9152037e-01
+   2.0274806e-02   7.6422452e-03  -3.3716754e-02   5.7574135e-02   2.6965872e-01
+   2.1563774e-02   8.7288388e-03  -3.6092315e-02   6.0836212e-02   2.1199389e-01
+   6.5120234e-05  -1.5932597e-03   1.5281395e-03   2.1149095e-02   8.9172750e-02
+  -2.6656511e-03   2.4471790e-04   2.4209332e-03  -1.9494018e-04  -2.6870192e-02
+   3.3234626e-02   3.4604202e-02  -9.6418692e-02   7.6788808e-02   2.6090922e-01
+   2.7142304e-02   2.9890418e-02  -8.5612586e-02   6.8178526e-02   1.7897774e-01
+   2.8133522e-02   2.9140440e-02  -8.5853825e-02   5.5669974e-02   1.8452208e-01
+   9.0232406e-04  -7.7045326e-03   6.8022086e-03  -3.3906128e-03   8.6478777e-03
+  -5.1290856e-05   2.6528461e-03  -2.6015552e-03   4.4099549e-03   2.4169862e-02
+   9.2083458e-03   6.3865006e-03  -1.9754234e-02  -8.1027130e-03  -7.8987230e-02
+  -2.4908812e-03   1.0292888e-02  -1.1961394e-02  -9.1730473e-03  -8.0577696e-02
+   8.1000912e-03   1.0573750e-02  -2.2833228e-02   2.0709010e-02  -7.3584153e-02
+  -2.6674731e-03   2.6408620e-03   2.6611085e-05  -7.3910549e-03  -3.2500479e-03
+   2.6442976e-03  -1.4321920e-03  -1.2121056e-03   1.3696805e-02  -9.6448002e-04
+   2.9600291e-02   1.5452803e-02  -6.3658039e-02   4.1363595e-02   2.2006844e-01
+   2.7727209e-02   1.3725847e-02  -6.0058000e-02   7.4892461e-02   3.1036072e-01
+   2.3332686e-02   2.4741606e-02  -6.6679237e-02   6.2260924e-02   2.6301290e-01
+   2.1353187e-03   1.6911692e-03  -3.8264878e-03  -1.8295713e-02  -1.7516830e-02
+  -1.3574402e-03  -8.8210799e-04   2.2395482e-03   1.1048356e-02   6.4614677e-05
+   2.6681826e-02   2.6094616e-02  -6.4726493e-02   6.9542353e-02   1.8742456e-01
+   2.0533095e-02   3.0216024e-02  -6.2699170e-02   2.8299008e-02   1.2347877e-01
+   2.5825883e-02   2.8555289e-02  -6.6331224e-02   5.1385402e-02   1.8763740e-01
+   1.0573302e-03  -8.2984103e-04  -2.2748915e-04   2.9552052e-03  -2.3671456e-03
+   2.6380022e-03  -1.2699379e-03  -1.3680643e-03  -8.1308955e-03  -7.5490022e-03
+   1.4592568e-02   1.6432999e-02  -4.4544810e-02   2.0519937e-03   5.0037084e-04
+   1.4944818e-02   8.9656646e-03  -3.7429724e-02  -2.1650118e-02   3.8847013e-02
+   2.3274040e-02   7.6724843e-03  -4.4465766e-02   4.6917579e-03   7.1531695e-02
+   7.1946591e-03  -5.0304097e-03  -2.1642494e-03  -1.2221862e-02  -1.0439254e-02
+  -1.4263510e-03   1.8885813e-03  -4.6223029e-04   3.4789165e-03  -1.1787616e-02
+   9.7390595e-03   1.4691035e-03  -8.5411632e-03  -1.2427489e-01   1.6290245e-01
+   1.8625894e-02  -4.4140168e-03  -1.1544877e-02  -2.0998610e-01  -2.5300521e-02
+   2.4036485e-02  -4.9830778e-03  -1.6386407e-02  -1.7275099e-01   2.5052810e-02
+  -1.5686331e-03  -6.3688763e-03   7.9375094e-03   7.5716622e-04  -4.8449380e-02
+   2.0381185e-03   3.4835219e-03  -5.5216404e-03   1.7663216e-03   3.0581033e-02
+   1.7276334e-02   4.4066275e-03  -3.8138682e-02   9.2746280e-02   8.8242989e-02
+   1.5965226e-02   6.8109926e-03  -3.9231940e-02   6.1978267e-02   7.2452985e-02
+   1.8515749e-02   7.6204916e-03  -4.2591961e-02   9.1214057e-02   4.1780743e-02
+   2.4544605e-05   5.6942706e-03  -5.7188152e-03   1.8376117e-02   3.4074705e-04
+  -2.3385487e-04   1.2165681e-04   1.1219806e-04  -7.8595008e-03  -4.9601627e-03
+   2.0886687e-02   1.9463989e-02  -5.6580224e-02   6.3713128e-02   1.6805976e-01
+   1.5258338e-02   4.2864796e-02  -7.4352682e-02   7.8116437e-02   1.7535639e-01
+   1.6275091e-02   3.1855560e-02  -6.4360200e-02   6.2781450e-02   1.5483934e-01
+  -1.7841851e-03   1.2404237e-03   5.4376134e-04  -1.9747165e-02  -8.9146151e-03
+   1.3031855e-03  -5.2628777e-04  -7.7689776e-04   2.8204725e-03   1.2188667e-02
+   3.1790930e-02   3.1067199e-02  -1.0721239e-01   9.7188461e-02   1.5991536e-01
+   7.9748546e-03   4.5908814e-02  -9.8237932e-02   1.4561234e-01   2.4565998e-01
+   1.4342795e-02   3.7537115e-02  -9.6234174e-02   8.1809022e-02   1.7881626e-01
+   2.1147296e-03   2.9570102e-04  -2.4104306e-03  -4.6996531e-03  -5.5180000e-02
+  -2.9492688e-03   7.4307610e-04   2.2061927e-03  -2.2268041e-03   5.3638435e-03
+   2.0824446e-02   1.7334778e-02  -5.1665753e-02   6.5500532e-02   9.2063987e-02
+   1.2349813e-02   1.8479255e-02  -4.4335597e-02   4.6292436e-04  -4.4579153e-02
+   1.5434569e-02   1.8572538e-02  -4.7513636e-02   2.0517132e-02   4.1309860e-02
+  -1.6745782e-03   2.3787211e-04   1.4367061e-03   8.3236350e-04   1.1226774e-02
+  -6.2431385e-04   1.8619396e-03  -1.2376257e-03  -1.0674110e-02   1.9305229e-03
+   3.0040537e-02   2.8570077e-02  -7.3980361e-02  -2.1901058e-02   1.4976399e-01
+   2.5855760e-02   4.5494884e-02  -8.6720392e-02  -2.7343731e-02   9.6036357e-02
+   3.3317063e-02   3.0481941e-02  -7.9168751e-02  -4.4505749e-02   1.0944408e-01
+   3.3268743e-04   5.9149546e-03  -6.2476420e-03   1.1469665e-02   3.8709663e-02
+  -8.5524204e-04   1.4401586e-03  -5.8491656e-04  -8.3760659e-03  -1.4671336e-02
+   2.8090415e-02   1.5196169e-02  -4.7346739e-02   3.3743689e-02   4.4931635e-02
+   2.5743450e-02   1.4804109e-02  -4.4607714e-02   6.3189663e-02   1.1308353e-01
+   2.8886515e-02   2.5523251e-02  -5.8469921e-02   6.6907861e-02   1.1800401e-01
+   2.1476541e-03  -7.0908103e-04  -1.4385731e-03   3.8013032e-02   6.2301313e-02
+  -3.3032976e-04  -9.2415823e-04   1.2544880e-03  -1.1553803e-02  -2.7034366e-02
+   2.6051239e-02   9.5587156e-03  -5.2809202e-02   3.2979805e-02  -2.0183576e-02
+   2.3486428e-02   3.3515635e-03  -4.4037238e-02   1.8777392e-02  -9.3180438e-02
+   2.5067975e-02   1.7047130e-02  -5.9314352e-02   1.7664877e-02  -3.5831266e-02
+  -1.6972653e-03  -1.8327834e-03   3.5300487e-03   2.2364852e-02   3.0587602e-02
+   1.5913065e-03   3.6201835e-05  -1.6275083e-03   4.7545808e-03   2.6382416e-02
+   2.4299860e-02   1.5453890e-02  -4.2318458e-02   4.9763072e-02  -1.1107852e-03
+   2.1188200e-02   1.9271344e-02  -4.3024252e-02   4.9692194e-02   4.7327480e-02
+   2.1167885e-02   1.6678506e-02  -4.0411098e-02   5.7253590e-02   2.9346155e-02
+   4.4362199e-03  -5.4336547e-03   9.9743472e-04   1.1584810e-02  -3.1721428e-02
+  -1.6601992e-03  -6.8418934e-04   2.3443885e-03   7.5278285e-03   3.4597081e-02
+   9.5435123e-03   9.7521811e-03  -4.3099911e-02  -2.7851122e-02   8.9808847e-02
+  -8.6675488e-04   1.6940979e-02  -3.9878441e-02  -2.5294670e-02   5.9063168e-02
+   4.0593075e-03   1.4879236e-02  -4.2742761e-02  -8.7936197e-03   3.6442993e-02
+  -6.6788680e-04   1.6988073e-03  -1.0309205e-03   2.7436134e-02   5.3613821e-03
+   1.2387491e-03  -1.1890070e-03  -4.9742126e-05  -1.9781414e-02   2.2078003e-03
+   2.2297973e-02   2.2283492e-02  -7.8142770e-02  -6.0523193e-02   1.9850998e-01
+   2.2227709e-02   2.3524589e-02  -7.9313603e-02  -1.0319274e-01   1.1468083e-01
+   2.0342139e-02   1.2493563e-02  -6.6397007e-02  -8.3247695e-02   8.9821452e-02
+  -3.5096072e-03   2.5102610e-04   3.2585811e-03  -2.9609213e-02  -5.3477744e-02
+  -8.1657352e-05  -2.8876713e-03   2.9693286e-03   4.2868114e-03   1.9625779e-02
+   2.1546022e-02   2.1952874e-02  -6.3158298e-02   3.8860027e-02   1.7236947e-01
+   1.2681723e-02   2.0151881e-02  -5.2493005e-02   4.3301268e-02   2.8816912e-01
+   1.9071516e-02   1.7223306e-02  -5.5954223e-02   1.0865158e-02   1.6768472e-01
+   5.2676195e-04  -2.9334812e-03   2.4067193e-03  -1.2761591e-02  -3.9119673e-02
+  -1.8585872e-04   1.6772875e-03  -1.4914288e-03   5.3966706e-03  -7.3446350e-03
+   4.3516716e-02   3.4811618e-02  -1.1560140e-01   6.1087997e-02   1.5099600e-01
+   3.7566696e-02   3.4656133e-02  -1.0949590e-01   6.0548685e-02   1.0416522e-01
+   3.7929559e-02   2.9028719e-02  -1.0423135e-01   9.7713433e-02   2.6258438e-01
+   3.5961771e-03  -2.4578679e-03  -1.1383093e-03   4.0093551e-03  -3.5668241e-02
+  -5.6326444e-05   2.2542749e-03  -2.1979485e-03  -1.9846108e-02   3.1014215e-04
+   4.7315513e-01   3.8008535e-01  -1.2004574e+00   6.1821798e-01   2.1634633e+00
diff --git a/bin/lpredm b/bin/lpredm
new file mode 100755 (executable)
index 0000000..dc2e627
Binary files /dev/null and b/bin/lpredm differ
diff --git a/bin/run_crn.sh b/bin/run_crn.sh
new file mode 100755 (executable)
index 0000000..44017fa
--- /dev/null
@@ -0,0 +1,52 @@
+#!/bin/sh
+
+DB=uniref100
+method=crnpred
+
+Usage () {
+echo "Usage: $0 [-m method] [-d DB] input_seq"
+echo "  input_seq: protein sequence in the FASTA format."
+echo "  method: 'crnpred2k', 'crnpred5k' or 'linear' (default: crnpred2k)"
+echo "  DB: BLAST sequence database (default: uniref100)"
+exit 2
+}
+
+#Usage
+args=`getopt m:d:h $*`
+set -- $args
+
+for i in $*; do
+  case "$i" in
+    -m) method=$2; shift 2;;
+    -d) DB=$2; shift 2;;
+    -h) Usage ;;
+    --) shift; break;;
+  esac
+done
+inseq=${1}
+
+if [ "hoge${inseq}" = "hoge" ]; then
+  Usage
+fi
+
+prof=`basename ${inseq}`.d.prof
+fout=`basename ${inseq}`.d.out
+
+blastpgp -d $DB -h 0.0005 -j 3 -i $inseq -Q $prof > /dev/null 2>&1 
+
+echo "# Input sequence" > $fout
+cat $inseq >> $fout
+echo '' >> $fout
+echo '' >> $fout
+
+echo "*** SS, CN, RWCO predictions..."
+if [ "$method" = "crnpred2k" ]; then
+  echo "   prediction by CRN2000 (takes some time...)"
+  ${CRNPRED_DIR}/bin/xpredm2000 $prof >> $fout
+elif [ "$method" = "crnpred5k" ]; then
+  echo "   prediction by CRN5000 (takes some time...)"
+  ${CRNPRED_DIR}/bin/xpredm5000 $prof >> $fout
+else
+  echo "   prediction by linear method"
+  ${CRNPRED_DIR}/bin/lpredm $prof >> $fout
+fi
diff --git a/bin/xpredm2000 b/bin/xpredm2000
new file mode 100755 (executable)
index 0000000..28ac5bd
Binary files /dev/null and b/bin/xpredm2000 differ
diff --git a/bin/xpredm5000 b/bin/xpredm5000
new file mode 100755 (executable)
index 0000000..2238696
Binary files /dev/null and b/bin/xpredm5000 differ
diff --git a/make.sh b/make.sh
new file mode 100755 (executable)
index 0000000..c550cee
--- /dev/null
+++ b/make.sh
@@ -0,0 +1,9 @@
+#!/bin/sh
+
+cd src
+make clean
+make NDIM=5000 install
+make clean
+make NDIM=2000 install
+make NDIM=2000 clean
+cd ..
diff --git a/sample/3chyA.fa b/sample/3chyA.fa
new file mode 100644 (file)
index 0000000..253e5fc
--- /dev/null
@@ -0,0 +1,4 @@
+>3CHYA:CHEY
+ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMP
+NMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLN
+KIFEKLGM
diff --git a/sample/3chyA.out b/sample/3chyA.out
new file mode 100644 (file)
index 0000000..3e153fe
--- /dev/null
@@ -0,0 +1,2 @@
+*** SS, CN, RWCO predictions...
+   prediction by CRN2000 (takes some time...)
diff --git a/sample/d1a6m__.out b/sample/d1a6m__.out
new file mode 100644 (file)
index 0000000..bb197ec
--- /dev/null
@@ -0,0 +1,168 @@
+>prediction for: sample/d1a6m__.prof
+
+#                  *         *         *         *         *         *
+AA:       VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASED
+SS:       CCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCH
+CN:       BBBBBEBBBEBBEEBEEEBBBBBEEEEEEEEEEEEEBBEBBEBBBBBBBBBBBBBBBBBB
+#                  *         *         *         *         *         *
+AA:       LKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHP
+SS:       HHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHCC
+CN:       BBBBEBEEEEEEEBEEBEEBBEBBEEEBEBBBEEBBEBBBBBBEEEEEEEEEEEEEEEEB
+#                  *         *         * 
+AA:       GDFGADAQGAMNKALELFRKDIAAKYKELGY
+SS:       CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCC
+CN:       BBBBBEEEEEEEEEEEEEEEEEBBEBBBBBB
+//
+
+>#   AA : SS P_H P_E P_C : CN     : RWCO
+    1 V : C    7   6  87 : B   13 :  801
+    2 L : C   10   7  83 : B   21 : 1224
+    3 S : C   27  11  62 : B   13 :  727
+    4 E : H   67  10  23 : B    9 :  472
+    5 G : H   85   7   9 : B   11 :  642
+    6 E : H   88   6   6 : E   19 :  976
+    7 W : H   89   5   6 : B   20 : 1028
+    8 Q : H   89   5   6 : B   15 :  719
+    9 L : H   90   5   6 : B   22 : 1142
+   10 V : H   90   5   6 : E   32 : 1337
+   11 L : H   90   5   5 : B   21 :  804
+   12 H : H   90   5   5 : B   22 :  849
+   13 V : H   90   5   6 : E   34 : 1520
+   14 W : H   89   5   6 : E   31 : 1343
+   15 A : H   86   7   8 : B   24 :  914
+   16 K : H   79   9  13 : E   27 : 1179
+   17 V : H   59  12  29 : E   33 : 1381
+   18 E : C   24  10  66 : E   21 :  828
+   19 A : C   11   7  82 : B   16 :  617
+   20 D : C   11   7  83 : B   18 :  674
+   21 V : C   14   8  78 : B   24 :  879
+   22 A : C   18   9  73 : B   14 :  544
+   23 G : C   27  10  63 : B   15 :  589
+   24 H : C   39  11  51 : E   26 : 1022
+   25 G : H   60  10  31 : E   27 : 1004
+   26 Q : H   83   6  10 : E   25 :  972
+   27 D : H   90   5   5 : E   25 :  793
+   28 I : H   91   5   4 : E   33 : 1137
+   29 L : H   91   5   4 : E   36 : 1193
+   30 I : H   91   5   5 : E   30 :  935
+   31 R : H   89   5   5 : E   29 :  988
+   32 L : H   88   7   6 : E   33 : 1197
+   33 F : H   83  10   7 : E   33 : 1183
+   34 K : H   66  20  14 : E   25 :  826
+   35 S : H   43  22  35 : E   27 :  970
+   36 H : C   23  13  64 : E   26 :  960
+   37 P : C   15   8  77 : B   18 :  589
+   38 E : C   13   8  79 : B   17 :  555
+   39 T : C   16   9  75 : E   23 :  646
+   40 L : C   22  12  65 : B   22 :  561
+   41 E : C   28  14  58 : B   17 :  290
+   42 K : C   32  14  54 : E   23 :  703
+   43 F : C   25  12  63 : B   24 :  674
+   44 D : C   14  10  77 : B   13 :  191
+   45 R : C   10   8  83 : B   15 :  365
+   46 F : C    8   8  84 : B   24 :  757
+   47 K : C    8   8  85 : B   14 :  306
+   48 H : C    7   8  85 : B   17 :  368
+   49 L : C    7   8  85 : B   21 :  463
+   50 K : C    7   8  85 : B   15 :  188
+   51 T : C    8   8  84 : B   14 :  155
+   52 E : C   11   8  81 : B   15 :  180
+   53 A : C   11   9  80 : B   13 :  138
+   54 E : C   10   9  81 : B   17 :  315
+   55 M : C    8   8  84 : B   20 :  442
+   56 K : C    8   7  85 : B   18 :  442
+   57 A : C    9   7  84 : B   16 :  444
+   58 S : C   14   7  78 : B   19 :  529
+   59 E : C   29   9  62 : B   13 :  285
+   60 D : H   52  10  38 : B   17 :  458
+   61 L : H   73   8  19 : B   26 :  806
+   62 K : H   82   7  11 : B   17 :  544
+   63 K : H   79   6  15 : B   14 :  428
+   64 H : H   63   7  30 : B   22 :  856
+   65 G : H   56   9  35 : E   24 :  704
+   66 V : H   69  10  21 : B   21 :  588
+   67 T : H   78  10  12 : E   23 :  634
+   68 V : H   84   8   8 : E   35 : 1214
+   69 L : H   88   6   6 : E   33 : 1066
+   70 T : H   90   5   5 : E   25 :  629
+   71 A : H   90   5   5 : E   33 : 1099
+   72 L : H   91   4   5 : E   36 : 1209
+   73 G : H   91   4   5 : E   23 :  617
+   74 A : H   90   4   5 : B   19 :  408
+   75 I : H   89   5   6 : E   32 : 1068
+   76 L : H   86   6   8 : E   29 :  969
+   77 K : H   72   9  19 : B   18 :  332
+   78 K : C   38  10  51 : E   19 :  532
+   79 K : C   16   8  76 : E   23 :  809
+   80 G : C   11   7  82 : B   17 :  555
+   81 H : C   14   8  78 : B   17 :  526
+   82 H : C   32  10  58 : E   26 :  885
+   83 E : H   65  10  25 : B   14 :  402
+   84 A : H   81   8  11 : B   17 :  388
+   85 E : H   85   7   7 : E   24 :  665
+   86 L : H   88   6   6 : E   28 :  808
+   87 K : H   89   5   6 : E   20 :  369
+   88 P : H   89   5   6 : B   16 :  197
+   89 L : H   89   5   6 : E   29 :  764
+   90 A : H   88   6   6 : B   25 :  644
+   91 Q : H   86   6   8 : B   18 :  327
+   92 S : H   75   8  17 : B   21 :  635
+   93 H : H   49  10  41 : E   24 :  754
+   94 A : C   27  10  64 : E   26 :  761
+   95 T : C   17   9  75 : B   18 :  496
+   96 K : C   12   8  80 : B   17 :  389
+   97 H : C    9   8  83 : E   25 :  769
+   98 K : C    8   8  84 : B   18 :  497
+   99 I : C    9   8  83 : B   27 :  864
+  100 P : C   11   8  82 : B   20 :  539
+  101 I : C   18   8  74 : B   23 :  596
+  102 K : C   42  10  48 : B   17 :  481
+  103 Y : H   72   9  19 : B   25 :  797
+  104 L : H   85   7   9 : E   31 : 1052
+  105 E : H   88   5   6 : E   24 :  716
+  106 F : H   89   5   6 : E   30 : 1104
+  107 I : H   90   4   6 : E   34 : 1333
+  108 S : H   90   4   6 : E   29 : 1029
+  109 E : H   90   4   6 : E   27 :  965
+  110 A : H   90   4   6 : E   35 : 1364
+  111 I : H   90   4   5 : E   38 : 1417
+  112 I : H   90   5   6 : E   35 : 1086
+  113 H : H   89   5   6 : E   32 :  998
+  114 V : H   89   5   6 : E   34 : 1074
+  115 L : H   89   5   6 : E   34 : 1144
+  116 H : H   88   6   7 : E   30 :  991
+  117 S : H   80   8  12 : E   24 :  810
+  118 R : H   53  11  37 : E   22 :  812
+  119 H : C   18   8  74 : E   24 :  876
+  120 P : C    9   6  86 : B   17 :  518
+  121 G : C    8   6  87 : B   12 :  315
+  122 D : C    8   7  84 : B   17 :  539
+  123 F : C   11   9  79 : B   25 :  770
+  124 G : C   28  12  60 : B   19 :  527
+  125 A : H   67  10  23 : B   20 :  584
+  126 D : H   85   7   8 : E   19 :  767
+  127 A : H   88   6   6 : E   30 : 1134
+  128 Q : H   89   6   5 : E   28 : 1046
+  129 G : H   89   5   5 : E   25 : 1057
+  130 A : H   90   5   5 : E   31 : 1329
+  131 M : H   91   4   5 : E   31 : 1515
+  132 N : H   90   4   5 : E   21 :  895
+  133 K : H   90   4   5 : E   26 : 1161
+  134 A : H   90   5   5 : E   35 : 1594
+  135 L : H   90   4   5 : E   32 : 1529
+  136 E : H   90   5   6 : E   24 :  984
+  137 L : H   90   5   6 : E   29 : 1312
+  138 F : H   90   5   6 : E   37 : 1727
+  139 R : H   90   5   6 : E   31 : 1372
+  140 K : H   90   4   6 : E   23 : 1204
+  141 D : H   90   4   6 : E   28 : 1452
+  142 I : H   89   5   6 : E   33 : 1624
+  143 A : H   89   5   6 : B   25 : 1197
+  144 A : H   89   5   6 : B   16 :  892
+  145 K : H   89   5   6 : E   21 : 1117
+  146 Y : H   86   6   8 : B   25 : 1342
+  147 K : H   80   8  12 : B   17 :  874
+  148 E : H   62  11  27 : B   16 :  869
+  149 L : C   27  11  62 : B   17 : 1020
+  150 G : C   11   7  82 : B   13 :  805
+  151 Y : C    7   6  87 : B   18 : 1178
diff --git a/sample/d1a6m__.prof b/sample/d1a6m__.prof
new file mode 100644 (file)
index 0000000..63719d9
--- /dev/null
@@ -0,0 +1,160 @@
+
+Last position-specific scoring matrix computed, weighted observed percentages rounded down, information per position, and relative weight of gapless real matches to pseudocounts
+           A  R  N  D  C  Q  E  G  H  I  L  K  M  F  P  S  T  W  Y  V   A   R   N   D   C   Q   E   G   H   I   L   K   M   F   P   S   T   W   Y   V
+    1 V   -2 -4 -5 -5 -3 -3 -4 -5 -4  2  1 -4  6 -2 -4 -3 -2 -4 -3  5    0   0   0   0   0   0   0   0   0   5   5   0  27   0   0   0   0   0   0  64  0.99 0.65
+    2 L   -4 -5 -6 -6 -4 -5 -5 -6 -5  0  6 -5  0  3 -5 -5 -4  1 -2 -1    0   0   0   0   0   0   0   0   0   2  85   0   0  11   0   0   0   2   0   0  1.33 1.03
+    3 S   -1 -3  0 -3 -1 -3 -3 -3 -4 -4 -4 -3 -3 -5 -3  5  5 -5 -4 -3    0   0   2   0   1   0   0   0   0   0   0   0   0   0   0  52  43   0   0   0  1.18 1.09
+    4 E    4 -3 -2  5 -2 -1  1 -1 -2 -5 -5 -1 -3 -5  0  0 -2 -6 -5 -4   40   1   0  32   1   1   7   3   1   0   0   3   0   0   4   5   1   0   0   0  0.76 1.09
+    5 G    2 -1 -1  1 -5  0  3  1  0 -5 -5  2 -4 -2 -3  0 -1 -5 -4 -3   21   1   2   8   0   4  24  10   2   0   0  16   0   2   0   6   4   0   0   1  0.45 1.09
+    6 E   -4 -3 -1  5 -6 -1  6 -4 -3 -6 -6 -2 -5 -6 -4 -2 -3 -6 -5 -5    0   0   1  39   0   1  59   0   0   0   0   0   0   0   0   0   0   0   0   0  1.53 1.09
+    7 W   -3  4 -3 -4 -2 -1 -2 -4 -2 -4 -5  6 -2 -5 -4 -3 -3  6 -3 -5    0  19   0   0   1   1   1   0   0   0   0  65   1   0   0   0   1  11   0   0  1.35 1.09
+    8 Q    4 -2  0 -2 -3  3  0 -1  0 -4 -4  1 -3 -5 -4  1  2 -3 -4 -2   32   0   4   2   0  16   5   3   3   0   0   9   0   0   0  12  13   0   0   2  0.50 1.09
+    9 L    3 -2  2 -3 -3 -1 -3 -4  2  1  2 -3  1 -3 -4 -2  1 -5 -2  0   24   2  12   1   0   2   1   0   5   6  24   0   4   1   0   1   8   0   1   6  0.35 1.09
+   10 V   -3 -5 -6 -6 -3 -5 -5 -6 -6  6 -1 -5 -1 -3 -5 -4 -3 -5 -4  5    0   0   0   0   0   0   0   0   0  47   2   0   0   0   0   0   0   0   0  51  1.36 1.09
+   11 L   -1  1 -1 -4 -2  2 -3 -3 -2 -1  1  4 -2 -4 -4 -1  3 -5 -4  0    4   6   3   0   1   8   0   1   1   3  16  32   1   0   0   3  17   0   0   6  0.45 1.09
+   12 H    3 -3  2  2 -3  0 -1  2  1 -4 -4 -1 -4 -5 -4  2  1 -5 -4 -3   26   0  10  10   0   3   3  12   4   1   0   2   0   0   0  19   8   0   0   1  0.46 1.09
+   13 V    0 -5 -5 -5 -2 -4 -5 -5 -4  3  3 -5  2  2 -5 -2  0 -4 -3  2    9   0   0   0   1   0   0   0   0  20  35   0   4   9   0   2   7   0   0  13  0.61 1.09
+   14 W   -5 -5 -6 -7 -3 -5 -5 -5 -5 -5 -3 -6 -3  3 -6 -5 -5 12  0 -5    0   0   0   0   0   0   0   0   0   0   1   0   0   9   0   0   0  89   0   0  3.53 1.09
+   15 A    2 -4 -1  1 -4 -1  0  5 -3 -5 -5 -2 -4 -5 -2  1 -2 -5 -5 -4   21   0   1   7   0   2   7  43   1   0   0   2   0   0   2  12   2   0   0   1  0.75 1.09
+   16 K   -2  1 -3 -3 -3 -1 -2 -4  1 -5 -4  7 -4 -5 -3 -2 -3 -5 -4 -4    1   4   0   0   1   1   0   0   3   0   1  86   0   0   1   1   1   0   0   1  1.49 1.08
+   17 V   -1 -5 -5 -6 -3 -5 -5 -6 -5  5  0 -5  2 -3 -5 -4 -2 -5 -4  5    5   0   0   0   0   0   0   0   0  30   7   0   5   0   0   0   0   0   0  53  1.09 1.08
+   18 E    1 -2  0 -1 -2 -1  2  2 -1 -2 -2 -1 -2 -1 -2  2 -1 -2  1 -2   14   1   4   2   1   2  17  16   1   2   4   2   1   2   1  18   3   0   6   2  0.26 0.79
+   19 A    2 -2 -1 -1 -2  0 -1  3 -2 -3 -2  0 -2 -3  2  1  0 -3 -2 -2   16   2   2   2   1   4   3  23   1   1   3   7   1   1  10  12   7   0   2   2  0.30 0.78
+   20 D   -3 -1  5  4 -4  1 -1 -3  5 -5 -5  2 -4 -5 -4  0 -3 -5 -3 -3    1   3  26  26   0   6   1   0  16   0   0  12   0   0   0   6   0   0   0   2  0.85 1.05
+   21 V    3 -3 -4 -4  3 -1 -2 -1 -4  1  1 -3 -2 -3 -4  0 -1 -4  0  4   25   1   0   0   7   2   2   4   0   7  11   0   0   0   0   6   2   0   3  28  0.41 1.04
+   22 A    2 -3 -1  4 -5 -2  4  1 -3 -5 -5 -1 -4 -5  0 -1 -3 -5 -4 -4   19   0   1  28   0   0  30  10   0   0   0   3   0   0   4   2   0   0   0   1  0.73 1.03
+   23 G    1 -3 -2  4 -5  1  4  1 -2 -3 -4 -1 -4 -4 -3 -1 -2 -5 -4 -2   13   0   1  24   0   4  33  11   1   1   1   3   0   1   0   3   1   0   0   3  0.63 1.05
+   24 H   -1 -4 -4 -3  1 -4 -4 -5  4  4  0 -4 -1  1 -5 -4 -2 -3  4  2    6   0   0   2   3   0   0   0  13  30   7   0   1   4   0   0   1   0  15  17  0.68 1.06
+   25 G   -2 -5 -3 -4 -3 -4 -4  7 -4 -6 -6 -4 -3 -5 -4 -3 -3 -5 -5 -5    1   0   0   0   0   0   0  96   0   0   0   0   1   0   0   0   1   0   0   1  1.98 1.07
+   26 Q    4 -3 -1 -4 -4  2 -2  3  2 -4 -4 -2 -3 -5  1 -1  0 -5 -3  0   33   0   3   0   0  11   2  21   4   0   1   1   0   0   8   3   4   0   0   8  0.51 1.07
+   27 D    0 -2 -2  2 -3  2  6 -4 -2 -5 -5 -1 -4 -5 -3 -1 -2 -5 -4 -4    7   0   0  11   0   6  67   0   0   0   0   2   0   0   0   3   1   0   0   1  1.18 1.07
+   28 I    5 -4 -4 -4 -3 -3 -3 -3 -4  1 -2 -3 -2 -4 -3 -1  1 -5 -4  2   64   0   0   0   0   0   0   0   0   8   1   0   0   0   0   2  11   0   0  14  0.90 1.05
+   29 L   -4 -5 -6 -6 -4 -5 -5 -6 -5  0  6 -5  1  0 -5 -5 -4 -4 -3 -1    0   0   0   0   0   0   0   0   0   2  93   0   2   2   0   0   0   0   0   1  1.44 1.05
+   30 I    1 -3 -3 -2 -2 -2  3  3 -1  2 -2 -3 -1 -4 -4  1 -1 -4 -2 -1   11   0   0   1   1   1  19  24   1  16   2   0   1   0   0  11   4   0   2   4  0.38 1.05
+   31 R   -4  8 -3 -4 -4 -1 -2 -4 -3 -5 -5  0 -4 -5 -4 -2 -3 -5 -4 -5    0  96   0   0   0   0   0   1   0   0   0   1   0   0   0   1   0   0   0   0  1.98 1.05
+   32 L   -3 -4 -5 -6  2 -4 -5 -5 -4 -1  4 -4  7  1 -5 -4  0 -4 -3 -1    0   0   0   0   4   0   0   0   0   0  49   0  34   5   0   0   5   0   0   2  1.10 1.04
+   33 F   -4 -5 -5 -6 -4 -5 -5 -6 -4  0  4 -5  0  7 -6 -5 -4 -2 -1 -1    0   0   0   0   0   0   0   0   0   2  44   0   1  50   0   0   0   0   0   1  1.34 1.04
+   34 K   -1 -3 -3 -4 -1 -1 -3 -5 -2  3  1  1  0 -3 -4 -2  1 -5 -3  4    5   1   1   0   1   3   1   0   1  20  13  11   1   0   0   2  10   0   0  30  0.47 1.04
+   35 S    0 -4  2 -3  1 -3 -3 -1 -4  0 -3 -4 -2 -4 -4  2  0 -5 -4  5    8   0   9   1   2   0   1   6   0   2   0   0   0   0   0  18   6   0   0  47  0.61 1.04
+   36 H   -4 -4 -3 -5 -5 -4 -4 -5  5 -3 -3 -4 -3  5 -5 -3 -4 -1  8 -4    1   0   1   0   0   0   0   0  15   0   0   0   0  25   0   1   0   0  57   0  1.70 1.04
+   37 P   -3 -4 -4 -4 -5 -4 -3 -4 -4 -5 -5 -3 -5 -6  9 -3 -3 -6 -5 -5    0   0   0   0   0   0   1   1   0   0   0   0   0   0  98   0   0   0   0   0  2.78 1.04
+   38 E   -2 -3 -3 -3 -5  5  2 -3 -3 -5 -4 -1 -3 -3 -2  1  1  9 -2 -4    3   0   0   0   0  30  12   1   0   0   0   3   0   0   1  11   8  31   0   0  1.23 1.04
+   39 T    0 -3 -2 -3 -3 -3 -3 -4 -4 -3 -4 -2 -3 -4 -3  0  7 -5 -4 -2    5   0   0   0   0   0   0   0   0   0   0   2   0   0   0   5  87   0   0   0  1.48 1.04
+   40 L   -3  0 -2 -3 -5  5 -1 -4 -2 -4  0  6 -1 -5 -4 -2 -3 -5 -4 -4    0   3   0   0   0  29   0   0   0   0  11  54   1   0   0   1   0   0   0   0  1.09 1.04
+   41 E   -2  5 -3 -1 -4  1  1 -4 -3 -1 -4 -1 -3 -5 -4 -2  5 -5 -4 -2    2  32   0   3   0   7   9   0   0   4   0   0   0   0   0   1  39   0   0   2  0.81 1.06
+   42 K   -4 -1 -4 -5 -5 -3 -4 -5  2 -4 -3  1 -3  4 -5 -3 -4 -1  8 -4    0   2   0   0   0   0   0   0   4   0   1  10   0  18   0   1   0   0  63   0  1.58 1.06
+   43 F   -5 -5 -6 -6 -5 -6 -6 -6 -4 -2 -1 -6 -2  9 -6 -5 -5 -1  1 -3    0   0   0   0   0   0   0   0   0   0   1   0   0  99   0   0   0   0   0   0  2.30 1.06
+   44 D    1 -3 -2  3 -4 -1  0  0 -2 -5 -5 -2 -4 -5  4  4 -1 -6 -5 -4   10   0   0  19   0   1   6   6   1   0   0   2   0   0  20  33   1   0   0   0  0.73 1.05
+   45 R   -3 -2  0  0 -5  1 -2 -2  8 -5 -5  2 -4 -4 -4  2 -1 -5 -2 -5    1   1   4   5   0   7   1   2  47   0   0  15   0   0   0  15   2   0   0   0  1.15 1.05
+   46 F   -4 -5 -5 -6 -5 -5 -5 -5 -4 -1 -1 -5 -1  8 -6 -5 -4  7  1 -3    0   0   0   0   0   0   0   0   0   2   4   0   1  74   0   0   0  17   1   0  1.93 1.04
+   47 K   -1 -2 -1  4 -5  0 -2  4 -3 -5 -5  3 -4 -5 -1 -2 -2 -5 -4 -5    4   1   1  27   0   3   0  35   0   0   0  21   0   0   2   2   2   0   0   0  0.79 1.00
+   48 H   -3 -3  4  4 -4 -2 -2 -2  4 -3  2 -2  0 -1 -4 -1 -3 -4 -3 -3    1   0  23  27   0   1   1   2  12   0  20   2   3   2   0   3   1   0   0   1  0.63 0.96
+   49 L   -2 -2 -3 -3 -2 -2 -2 -3  1  1  5 -2  3 -1 -2 -2 -2 -2 -2  0    2   2   1   2   1   1   2   2   3   7  54   2   7   1   2   4   2   0   1   4  0.55 0.74
+   50 K   -1 -1 -1 -1  0 -1  1 -1  1 -3 -3  2 -2 -2 -2  4  0 -2  0 -2    4   2   1   2   2   2   8   3   3   2   3  14   1   1   2  40   4   0   4   2  0.41 0.74
+   51 T    0 -1  2  1 -1 -1  0 -1 -1 -2 -2 -1 -2 -2 -1  3  2 -2 -2 -2    5   2  10   8   1   2   5   4   1   2   4   3   1   2   2  27  16   1   1   3  0.28 0.59
+   52 E    2 -2  0 -1 -2  0  2 -1 -2 -1 -1 -1 -2 -2  4  0 -1 -2 -2 -1   21   2   5   3   1   3  12   3   1   3   6   2   1   2  20   6   4   1   1   4  0.31 0.62
+   53 A    1 -1  0  3 -1  0  1  0 -1 -2 -1 -1 -2 -2 -1  2  0 -2 -2 -2   15   2   3  18   1   4  11   6   1   2   6   3   1   2   2  13   5   1   1   3  0.21 0.62
+   54 E    4 -2 -2  0 -2  0  3 -1 -1 -1 -1 -1 -2 -2 -2 -1 -1 -2 -2  0   35   2   2   4   1   4  21   3   1   3   5   2   1   2   2   3   3   0   1   7  0.34 0.66
+   55 M   -2 -3 -2 -3 -1 -2 -2 -1  1  4 -1 -2  5 -2 -3  2 -1 -3 -3  1    2   1   2   1   1   1   2   4   4  26   4   1  18   1   1  19   3   0   1   9  0.45 0.87
+   56 K   -2 -1 -3 -3 -1  0  0 -4  4 -2 -1  2  5 -2  5 -2 -3 -4 -3 -3    3   2   0   0   2   4   7   0  11   2   6  12  17   1  27   2   1   0   0   1  0.66 1.00
+   57 A    0  0  0 -1 -3 -1 -2  6  2 -5 -5 -1 -4 -5 -4  0 -3 -5 -4 -5    8   4   5   2   0   2   2  62   5   0   0   3   0   0   0   5   1   0   0   0  1.03 1.03
+   58 S   -1 -3  5 -2 -4 -2 -2 -2 -1 -5 -5 -2 -4 -5 -3  6 -1 -5 -4 -4    1   0  33   0   0   0   0   0   1   0   0   0   0   0   0  64   1   0   0   0  1.26 1.05
+   59 E    3 -3 -2 -1 -4  0  3 -1 -2 -3 -4 -1 -4 -5  4  0 -1 -5 -4 -2   31   0   1   2   0   4  19   3   1   1   1   2   0   0  24   8   2   0   0   2  0.66 1.05
+   60 D   -2  0 -1  3 -5  5  0 -4  1 -5 -4  4 -1 -5  2 -2 -3 -5 -4 -4    2   3   2  18   0  31   2   0   4   0   0  25   2   0   9   2   0   0   0   0  0.80 1.05
+   61 L   -3 -5 -5 -6 -3 -4 -5 -5 -5  3  3 -5  0 -3 -5 -4 -3 -5 -4  6    1   0   0   0   0   0   0   0   0  13  28   0   1   0   0   0   0   0   0  56  1.06 1.05
+   62 K    0  4 -2 -3 -5  1 -2 -4  0 -4 -3  6 -3 -5 -3 -1 -3 -5 -4 -4    9  23   1   0   0   6   0   0   2   0   2  52   0   0   1   3   0   0   0   0  0.99 1.05
+   63 K    4 -1 -1 -3 -4 -1 -1  0  0 -4 -4  4 -4 -5 -3  0 -1 -5 -4 -2   42   1   3   0   0   1   3   5   3   0   0  32   0   0   1   3   3   0   0   3  0.68 1.06
+   64 H   -4 -3 -2 -3 -5  0 -2 -3 11 -6 -5 -3 -4 -4 -5 -3 -4 -5 -1 -5    0   0   0   0   0   3   0   1  96   0   0   0   0   0   0   0   0   0   0   1  2.59 1.06
+   65 G    0 -5 -3 -4 -2 -4 -4  7 -4 -6 -6 -3 -5 -6 -4 -2 -4 -5 -5 -5    7   0   0   0   1   0   0  90   0   0   0   1   0   0   0   1   0   0   0   0  1.82 1.06
+   66 V    0  1  0 -3 -1  1 -1  0 -1 -2 -4  6 -3 -5 -4 -1 -1 -5 -4 -1    7   7   5   0   2   5   2   6   1   3   0  52   0   0   0   2   4   0   0   4  0.69 1.05
+   67 T   -3  2 -2 -3 -5 -2 -2 -4 -3 -2 -4  6 -3 -5 -4 -2  4 -5 -4  0    0  10   0   0   0   0   0   0   0   2   1  54   0   0   0   0  25   0   0   7  0.98 1.06
+   68 V   -3 -5 -5 -6 -3 -5 -5 -6 -6  3 -1 -5 -1 -2 -5 -4 -2 -5 -4  7    0   0   0   0   0   0   0   0   0  15   1   0   1   1   0   0   1   0   0  81  1.39 1.06
+   69 L    1 -4 -5 -6 -2 -4 -4 -3 -5  0  4 -4  6  0 -5 -3 -3 -4 -3  1   12   0   0   0   0   0   0   1   0   3  44   0  28   3   0   1   0   0   0   8  0.90 1.06
+   70 T    1 -2  3  2 -4 -2 -2  3  1 -4 -4 -2 -4 -5 -4  0  4 -5 -4 -3   11   1  13  13   0   1   1  23   3   0   1   1   0   0   0   4  26   0   0   1  0.57 1.06
+   71 A    5 -4 -3 -4 -3 -2 -3  2 -4 -4 -4 -3 -2 -5 -3  2 -1 -5 -4 -3   62   0   0   0   0   1   0  17   0   0   0   0   1   0   0  17   1   0   0   0  1.00 1.05
+   72 L   -4 -5 -6 -6 -4 -5 -5 -6 -5  3  4 -5  0  4 -5 -5 -3 -4 -2  3    0   0   0   0   0   0   0   0   0  15  49   0   0  18   0   0   0   0   0  17  0.98 1.06
+   73 G    0 -4  2  1 -4 -3 -1  5 -2 -4 -4 -3 -3 -5 -4  0  2 -5 -4 -3    7   0  10   7   0   0   4  49   1   1   1   0   0   0   0   6  12   0   1   2  0.80 1.06
+   74 A   -2  1  2  3 -5  0  4  0 -2 -4 -1  1 -4 -5 -4 -1  1 -5 -4 -4    2   7   9  19   0   3  26   8   1   0   6   8   0   0   0   2  10   0   0   0  0.49 1.06
+   75 I    6 -4 -4 -4 -2 -4 -4  1 -4  2 -2 -3 -3 -4 -3 -1 -2 -5 -4  0   67   0   0   0   0   0   0  11   0  12   3   0   0   0   1   1   0   0   0   5  0.93 1.06
+   76 L    0 -5 -5 -5 -2 -4 -4 -5 -5  2  2 -5 -1 -3 -5 -3 -1 -5 -4  6    8   0   0   0   1   0   0   0   0   9  21   0   1   0   0   1   3   0   0  57  0.91 1.06
+   77 K   -1 -1  2 -2 -3  0  1  1  0 -5 -5  6 -3 -5 -4  0 -2 -5 -4 -5    5   1  10   0   0   4   9  10   2   0   0  49   0   0   0   8   2   0   0   0  0.76 1.06
+   78 K   -3 -1  5 -1 -5 -1 -2 -4  7 -5 -4  3 -3 -4 -4  0 -3 -5 -1 -5    0   1  31   1   0   2   0   0  33   0   1  23   0   0   0   5   0   0   1   0  1.17 1.06
+   79 K   -4 -3 -5 -5 -4 -4 -4 -5 -5  4  4  1  5 -1 -3 -4 -3 -4 -3  0    0   0   0   0   0   0   0   0   0  25  43  12  15   1   1   0   0   0   0   3  0.85 1.06
+   80 G   -4 -4  0  7 -6 -2  0  2 -1 -6 -6 -3 -5 -6 -4 -2 -3 -6 -5 -6    0   0   2  78   0   1   2  13   2   0   0   0   0   0   0   1   0   0   0   0  1.62 1.06
+   81 H   -4 -3  5  6 -6  0 -1 -3  4 -6 -6 -2 -5 -5 -4 -2 -2 -6 -4 -5    0   0  35  47   0   4   0   1   9   0   0   2   0   0   0   1   1   0   0   0  1.31 1.06
+   82 H   -4 -4 -5 -5 -4 -3 -5 -6  4  4  4 -5  3 -2 -3 -4 -3 -4 -3  1    0   0   0   0   0   0   0   0  12  22  49   0   6   0   1   0   0   0   0  10  0.92 1.06
+   83 E    1 -1 -1  0 -4 -2  2 -3 -2 -4 -3  4 -4 -3  2  1  1 -5 -4 -1   10   2   2   5   0   0  11   0   1   0   2  33   0   1  11   8   8   0   0   5  0.48 1.06
+   84 A    3 -3  1 -1 -3 -1  0  5 -1 -5 -5 -3 -3 -5 -3  1  0 -5 -5 -3   24   0   5   3   0   2   5  38   1   0   0   1   1   0   0  11   6   0   0   1  0.65 1.06
+   85 E    3 -4 -3 -3 -2 -2  1  2 -1 -3 -4 -3 -3 -3 -4  0  4 -5 -3  1   32   0   0   0   1   0  11  14   2   0   0   0   0   1   0   3  26   0   1   9  0.55 1.05
+   86 L   -4 -5 -6 -6 -3 -5 -5 -6 -4  0  5 -5  1  4 -5 -4 -3 -3  3 -2    0   0   0   0   0   0   0   0   0   3  63   0   2  19   0   0   0   0  12   0  1.11 1.06
+   87 K    4 -2 -2 -3 -1 -1 -3 -1 -1 -4 -1  2 -2 -3 -2  4  0 -5 -4 -3   33   1   1   0   1   2   0   3   1   0   6  13   1   1   1  32   3   0   0   1  0.55 1.06
+   88 P    1 -2  1  0 -5  1  1 -3  0 -3 -2  3 -4 -5  3  1 -1 -5 -4 -3   15   1   6   5   0   6   9   0   3   1   4  22   0   0  15   8   4   0   0   1  0.42 1.06
+   89 L   -4 -5 -6 -6 -4 -5 -5 -6 -5  0  6 -5  0 -2 -5 -5 -3 -4 -3  1    0   0   0   0   0   0   0   0   0   1  92   0   0   0   0   0   0   0   0   7  1.44 1.06
+   90 A    2 -3 -2 -3 -3 -2 -3  0 -3 -5 -5 -3 -4 -5 -3  6 -1 -5 -4 -4   13   0   0   0   0   1   0   7   0   0   0   0   0   0   0  80   0   0   0   0  1.24 1.06
+   91 Q   -3 -1  0  4 -6  3  5 -4 -2 -2 -4  2 -4 -5 -4 -2 -2 -5 -4 -1    1   3   3  23   0  14  36   0   1   2   1  10   0   0   0   0   2   0   0   4  0.80 1.06
+   92 S    0 -3 -4 -5 -4 -2 -4 -5 -4 -1  5 -1  1 -2 -5  1 -2 -4 -2 -1    6   0   0   0   0   2   0   0   0   1  68   4   2   1   0  12   2   0   1   2  0.82 1.06
+   93 H   -4 -2 -1 -3 -6 -2 -2 -4 11 -6 -5 -3 -4 -4 -5 -3 -4 -5  0 -6    0   0   1   0   0   0   0   0  98   0   0   0   0   0   0   0   0   0   0   0  2.69 1.06
+   94 A    6 -4 -3 -4  6 -3 -4 -3 -4 -4 -4 -3 -3 -3 -3  1 -2 -5 -4 -3   69   0   0   0  19   0   0   0   0   0   0   0   0   1   0  10   0   0   0   0  1.24 1.06
+   95 T   -4 -3 -1  3 -3  0  2 -5  4 -3 -1 -3 -3  3 -4 -2  2 -3  4 -2    0   0   2  17   1   4  13   0   9   1   6   1   0  15   0   1  12   0  16   2  0.55 1.06
+   96 K   -3  1  1 -1 -5  1 -1 -4 -1 -3 -5  6 -2 -5 -4 -2  0 -5 -4 -3    0   4   7   2   0   6   2   0   1   2   0  66   1   0   0   1   6   0   0   2  1.04 1.06
+   97 H   -4 -4 -5 -5 -4 -4 -5 -6  5  0  6 -4  0 -1 -5 -4 -4 -4 -2 -2    0   0   0   0   0   0   0   0  19   2  76   0   1   1   0   0   0   0   1   0  1.26 1.06
+   98 K   -3  6  0 -4 -2 -1 -2 -4  7 -5 -4  3 -4 -4 -4 -3 -3 -5 -3 -5    1  43   3   0   1   1   0   0  28   0   1  21   0   1   0   0   0   0   0   0  1.25 1.06
+   99 I   -2 -5 -5 -6 -3 -5 -5 -6 -6  3 -1 -5 -1 -3 -5 -4 -1 -5 -4  7    0   0   0   0   0   0   0   0   0  15   0   0   0   0   0   0   1   0   0  83  1.43 1.06
+  100 P   -4 -4 -1  7 -6 -3  1 -4 -2 -6 -6 -3 -5 -6  2 -2 -3 -7 -5 -6    0   0   1  81   0   0   5   0   1   0   0   0   0   0  11   1   0   0   0   0  1.74 1.06
+  101 I   -3 -5 -5 -4 -2 -4 -4 -5 -5 -1 -4 -4 -4 -6  8 -3 -3 -6 -5  0    0   0   0   0   1   0   0   0   0   4   0   0   0   0  86   0   1   0   0   8  2.33 1.06
+  102 K    2 -3 -2  1 -3 -1  3  1 -4 -1 -4  2 -2 -5 -4 -2 -1 -5 -4  3   16   0   1   9   0   2  19  10   0   2   0  13   1   0   0   2   2   0   0  24  0.39 1.06
+  103 Y   -4 -3  8 -1 -5 -3 -3 -3 -1 -5 -5 -3 -4 -2 -5 -2 -3 -4  4 -5    0   0  80   0   0   0   0   0   0   0   0   0   0   1   0   1   0   0  18   0  1.73 1.06
+  104 L   -4 -5 -5 -6 -5 -5 -5 -5 -4 -2  1 -5 -2  9 -6 -5 -4 -1  1 -3    0   0   0   0   0   0   0   0   0   0  11   0   0  88   0   0   0   0   0   0  1.99 1.05
+  105 E   -3  4 -2 -3 -5  0  2 -3 -2 -5 -4  6 -1 -5 -1 -2 -3 -5 -4 -4    1  19   1   0   0   2  12   1   1   0   0  58   2   0   2   0   1   0   0   1  1.08 1.05
+  106 F   -4 -2 -5 -6 -4 -4 -5 -6 -5  3  5 -4  0  4 -5 -5 -3 -3 -1 -1    0   3   0   0   0   0   0   0   0  20  58   1   0  15   0   0   1   0   1   1  0.98 1.04
+  107 I   -3 -5 -6 -6 -4 -5 -5 -6 -5  2  6 -5  0  1 -5 -5 -3 -4 -3 -1    0   0   0   0   0   0   0   0   0  12  82   0   0   4   0   0   0   0   0   0  1.26 1.05
+  108 S    2 -3  0 -3  1 -3 -3  4 -4 -3 -5 -3 -4 -5 -4  4 -1 -5 -4 -4   19   1   3   0   3   0   0  29   0   1   0   0   0   0   0  41   2   0   0   0  0.84 1.05
+  109 E   -4 -3  3  2 -5  1  2  0  8 -5 -5 -2 -4 -4 -4 -2 -3 -5 -1 -5    0   0  17  14   0   6  12   9  38   0   1   0   0   0   0   1   1   0   2   0  1.06 1.05
+  110 A    1 -4  2 -4  8 -3 -4 -4 -4  1 -2 -4  0 -4 -5 -2 -1 -5 -4  3   10   0  12   0  39   1   0   0   0   8   1   0   3   0   0   1   3   0   0  22  1.08 1.05
+  111 I   -4 -5 -6 -6 -4 -5 -5 -6 -5  5  4 -5  2  2 -5 -5 -3 -4 -3  1    0   0   0   0   0   0   0   0   0  44  39   0   5   8   0   0   0   0   0   4  1.04 1.05
+  112 I   -2 -4 -5 -5 -4  1 -2 -5 -1  3  4 -4  1 -3 -5 -2  1 -5 -4  3    1   0   0   0   0   6   2   0   1  19  40   0   3   0   0   2   9   0   0  17  0.64 1.06
+  113 H   -2 -4 -4 -4  1  0  0 -5  1  3 -1 -2 -1 -3 -5 -3 -1 -5 -3  5    1   0   0   0   3   4   8   0   5  19   3   2   1   0   0   1   3   0   0  52  0.77 1.06
+  114 V   -1 -4 -4 -5  3 -4 -4 -5 -5  0 -2 -4 -2 -3 -4 -2  3 -5 -4  6    2   0   0   0   5   0   1   0   0   2   0   0   0   0   0   1  21   0   0  66  1.06 1.05
+  115 L   -3 -5 -5 -6 -1 -4 -5 -6 -5  3  5 -5  2  0 -5 -4 -2 -4 -3  2    1   0   0   0   1   0   0   0   0  15  64   0   3   3   0   0   1   0   0  11  1.00 1.05
+  116 H    6 -3 -3 -4  0  1 -3  1  0 -4 -4 -2 -2 -5 -3  0 -2 -5 -4 -2   72   0   0   0   2   6   0   9   2   0   0   1   1   0   0   6   0   0   0   1  1.00 1.05
+  117 S    2  1 -1 -3  2 -2  1 -2  1  1 -2 -2  3 -3 -4  2  0 -5 -4  0   19   7   3   0   4   1   9   2   4  10   2   2  10   1   0  16   6   0   0   5  0.27 1.05
+  118 R   -2  1  0 -1 -5 -1 -1 -4  8 -4 -1  3  2 -3 -4 -3 -3 -4  1 -4    3   5   4   3   0   1   2   0  44   1   5  19   5   1   0   0   1   0   5   0  1.02 1.05
+  119 H   -4 -4 -2 -5 -4 -3 -4 -5  6 -2  1 -4  1  7 -5 -4 -4 -2  3 -3    0   0   1   0   0   0   0   0  24   0  14   0   4  47   0   1   0   0   7   0  1.27 1.05
+  120 P    0 -4 -3 -4 -5 -1 -3  4 -1 -5 -5 -3 -5 -6  7  0 -2 -5 -5 -5    5   0   0   0   0   3   0  30   2   0   0   0   0   0  51   5   2   0   0   0  1.37 1.05
+  121 G    2 -1  0  1 -3 -1  1  2 -2 -4 -5  4 -4 -5 -3  1  0 -5 -4 -3   18   1   3   7   0   2   8  16   1   0   0  27   0   0   1   9   5   0   0   1  0.47 1.05
+  122 D   -1 -3  0  6 -2  0  4 -2 -2 -3 -4 -2 -4 -2 -3 -2 -3 -5 -3 -2    6   0   3  42   1   2  30   3   0   2   2   1   0   2   1   2   0   0   1   3  0.86 1.04
+  123 F   -4 -5 -5 -6 -5 -5 -5 -6 -3 -1  0 -5 -1  8 -5 -5 -4 -1  2 -3    0   0   0   0   0   0   0   0   0   2   6   0   1  85   1   0   0   0   4   1  1.90 1.05
+  124 G   -2 -3  0  0 -3 -3 -3  1 -1 -4 -4 -2 -3 -5 -1  1  6 -5 -4 -3    1   0   3   5   0   0   0  11   2   0   0   1   0   0   3   6  68   0   0   0  1.05 1.05
+  125 A    3 -4 -4 -4 -4 -3 -3 -2 -4 -4 -4 -3 -4 -5  7 -2 -3 -4 -4 -3   26   0   0   0   0   0   0   2   0   1   1   0   0   0  66   0   0   0   0   2  1.74 1.04
+  126 D    1 -2 -1  4 -3  2  5 -3 -1 -5 -5 -2 -4 -5 -2 -1 -1 -5 -4 -3   13   1   2  20   0   9  45   0   1   0   0   1   0   0   1   4   3   0   0   1  0.83 1.05
+  127 A    2 -4 -4 -5  1 -4 -4 -4 -3  1 -1 -4  1 -3 -4 -2  1 -2 -4  5   22   0   0   0   3   0   0   0   0   4   3   0   3   0   0   2   8   1   0  52  0.78 1.05
+  128 Q   -2 -2 -2 -2 -3  6 -1 -4  8 -4 -4 -2 -3 -4 -4 -3 -3 -4 -2 -5    3   0   0   1   1  46   2   0  45   1   1   0   0   0   0   0   0   0   0   0  1.59 1.04
+  129 G    5 -3 -3 -4 -3 -2  0  0 -3 -2  0 -2  0 -3 -4 -1 -2 -5 -4  2   55   1   0   0   0   1   6   6   0   1   8   2   2   1   0   3   1   0   0  13  0.63 1.05
+  130 A    5 -4 -2 -3 -2 -3 -3 -2 -4 -4 -4 -3 -3 -4 -2  3 -1 -5 -4 -1   63   0   1   1   1   0   0   0   0   0   0   0   0   0   1  27   2   0   0   4  1.00 1.05
+  131 M   -4 -5 -5 -6 -2 -4 -5 -5 -4 -1  2 -5  5  3 -5 -4 -3  9  2  1    0   0   0   0   1   0   0   0   0   3  18   0  17  13   0   0   0  31   7  10  1.31 1.05
+  132 N   -3 -2  1  6 -5  5  0 -3 -1 -5 -5  0 -4 -5 -4  0  0 -5 -3 -5    1   1   5  44   0  27   4   1   1   0   0   5   0   0   0   5   5   0   1   0  0.98 1.05
+  133 K   -3  0 -2 -3 -5 -1 -1 -4 -1 -5 -5  7 -4 -5 -3 -2 -3 -5 -4 -5    0   1   1   0   0   0   0   0   1   0   0  96   0   0   0   0   0   0   0   0  1.73 1.05
+  134 A    1 -5 -5 -6 -4 -5 -5 -5 -4 -2  2 -5  1  7 -5 -4 -4 -2  0  0   13   0   0   0   0   0   0   0   0   0  18   0   3  58   0   0   0   0   0   7  1.21 1.06
+  135 L   -3 -2 -5 -6 -4 -4 -4 -6 -5  0  5 -5  2  2 -5 -4 -3 -4 -3  3    1   2   0   0   0   0   0   0   0   1  61   0   5   8   0   1   1   0   0  19  0.94 1.07
+  136 E    4 -1 -1 -2  2  0  2 -1 -3 -4 -4 -2 -3 -5 -4  2  0 -5 -2 -2   40   3   3   2   5   5  14   3   0   0   0   0   0   0   0  18   5   0   1   1  0.54 1.07
+  137 L    3 -3  1 -3 -1 -1 -2  2  0 -1  1 -3 -3 -4 -4  0 -1 -5 -4  2   27   1   8   0   1   3   2  16   2   2  14   1   0   0   0   7   2   0   0  13  0.33 1.07
+  138 F   -3 -5 -5 -5 -3 -5 -5 -6 -5  2  2 -5  0  3 -5 -4 -3 -4 -2  6    0   0   0   0   0   0   0   0   0   7  16   0   2  14   0   0   0   0   0  61  1.05 1.07
+  139 R    4  2 -3 -4  1 -3 -3 -1 -3 -2 -4 -3 -3 -4 -4  3 -1 -5  1  1   38  12   1   0   3   0   1   3   0   1   0   0   0   0   0  23   2   0   5  10  0.57 1.07
+  140 K    1 -2  4 -1  0 -3 -2 -2  2 -3  1 -1 -3 -4 -4  2  3  2 -4 -3   11   2  19   3   2   0   1   2   6   1  13   4   0   0   0  15  18   3   0   1  0.39 1.07
+  141 D    5 -4 -3  2 -3 -3 -3 -2  2 -2 -2 -3 -1 -4 -4 -1 -1 -5 -4  3   50   0   0  13   0   0   0   1   5   0   2   0   1   0   0   3   2   0   0  23  0.71 1.07
+  142 I   -3 -5 -6 -6 -4 -5 -5 -6 -5  2  6 -5  3 -2 -5 -5 -3 -4 -3  1    0   0   0   0   0   0   0   0   0  10  77   0   7   0   0   0   0   0   0   6  1.24 1.07
+  143 A    4 -3 -3 -4 -1 -2 -3  1 -4 -4 -4 -2 -3 -3 -3  2  4 -5 -3 -2   40   0   0   0   1   1   0   9   0   0   1   2   0   1   1  16  25   0   1   2  0.70 1.08
+  144 A    2  2 -2  0 -4 -1  3 -1  4 -5 -4 -1 -4 -5 -4  3 -2 -5 -3 -4   17  12   0   4   0   2  20   3  12   0   1   3   0   0   0  25   0   0   0   0  0.57 1.07
+  145 K   -1  2 -2 -3 -5  2 -1 -2 -2 -5 -5  6 -4 -5 -4 -2 -2 -5 -4 -2    5  10   1   0   0  10   2   3   0   0   0  64   0   0   0   1   1   0   0   3  1.07 1.07
+  146 Y   -4 -4 -4 -5 -5 -4 -4 -6  1 -4 -3 -4 -3  1 -5 -4 -3  0  9 -4    0   0   0   0   0   0   0   0   2   0   0   0   0   1   0   0   1   0  96   0  2.39 1.07
+  147 K   -3  7 -2 -3 -5 -1  0 -4 -2 -5 -4  3 -4 -5 -4 -3  0 -5 -4 -5    0  71   0   0   0   0   4   0   0   0   0  21   0   0   0   0   5   0   0   0  1.42 0.92
+  148 E   -2 -2 -2  1 -5  1  6 -4 -2 -3  0 -1 -2 -4 -3 -2 -2 -4 -3 -2    0   0   0   3   0   0  85   0   0   0  10   0   0   0   0   0   0   0   0   1  1.03 0.44
+  149 L    2 -3 -4 -4 -2 -3 -4 -4 -4  0  4 -3  0  2 -4 -2 -2 -3 -2  2   22   0   0   0   0   0   0   0   0   0  48   0   0  12   0   0   0   0   0  19  0.50 0.44
+  150 G   -1 -3 -1 -2 -4 -3 -3  7 -3 -5 -5 -3 -4 -4 -3 -1 -3 -4 -4 -4    0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0  1.53 0.35
+  151 Y   -3 -4 -4 -5 -3 -4 -4 -4 -2 -2 -1 -4 -2  6 -5 -4 -3 10  3 -3    0   0   0   0   0   0   0   0   0   0   0   0   0  52   0   0   0  43   6   0  1.66 0.35
+
+                      K         Lambda
+Standard Ungapped    0.1344     0.3182
+Standard Gapped      0.0410     0.2670
+PSI Ungapped         0.2052     0.3178
+PSI Gapped           0.0628     0.2670
diff --git a/sample/d1ifra_.out b/sample/d1ifra_.out
new file mode 100644 (file)
index 0000000..73189a2
--- /dev/null
@@ -0,0 +1,126 @@
+>prediction for: sample/d1ifra_.prof
+
+#                  *         *         *         *         *         *
+AA:       GSHRTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKA
+SS:       CCCCCCCCEEEEEECCCCCEEEEEECCCCCCCCCCCEEEECCCCCCEEEEEECCCEECCC
+CN:       BBBBBBBBEEEEEBEBBBEEEEEEEBBBBBBBBBBBBBEEBBBBBBBBBEBBBBBBBBBB
+#                  *         *         *         *         *   
+AA:       GQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLV
+SS:       CCEEEEEECCCCCCCCCCCCEEECCCCCCCCCCCEEEEEECCCCCEEEEEEEC
+CN:       BEBEEEEEBBBBBBBBBBBEBBBBBBBBBBBBBBEEEEEBBBBBEEBEBEEBB
+//
+
+>#   AA : SS P_H P_E P_C : CN     : RWCO
+    1 G : C    5   6  89 : B   11 :  468
+    2 S : C    6   7  87 : B   12 :  504
+    3 H : C    7   8  85 : B   12 :  608
+    4 R : C    7   8  85 : B   13 :  654
+    5 T : C    6   7  87 : B   17 :  813
+    6 S : C    6   7  87 : B   15 :  711
+    7 G : C    6   9  85 : B   20 :  891
+    8 R : C    8  26  66 : B   19 :  846
+    9 V : E    8  70  22 : E   31 : 1284
+   10 A : E    5  88   8 : E   26 :  949
+   11 V : E    5  89   7 : E   33 : 1150
+   12 E : E    5  88   7 : E   21 :  782
+   13 E : E    7  84   9 : E   22 :  780
+   14 V : E    9  66  24 : B   28 :  906
+   15 D : C    9  27  64 : E   19 :  737
+   16 E : C    6  10  84 : B   18 :  674
+   17 E : C    5   7  88 : B   12 :  466
+   18 G : C    6   9  85 : B   18 :  639
+   19 K : C    8  26  66 : E   20 :  639
+   20 F : E    8  69  23 : E   28 :  938
+   21 V : E    5  87   7 : E   34 : 1081
+   22 R : E    5  90   5 : E   26 :  722
+   23 L : E    5  89   5 : E   34 : 1087
+   24 R : E    7  81  12 : E   24 :  699
+   25 N : E   11  48  41 : E   24 :  653
+   26 K : C    9  17  75 : B   18 :  541
+   27 S : C    7   9  84 : B   15 :  329
+   28 N : C    7   8  85 : B   13 :  237
+   29 E : C    7   8  85 : B   14 :  254
+   30 D : C    8   9  83 : B   16 :  321
+   31 Q : C    8  10  83 : B   19 :  396
+   32 S : C    7   9  84 : B   15 :  306
+   33 M : C    7   8  85 : B   23 :  630
+   34 G : C    6   8  86 : B   17 :  492
+   35 N : C    6  11  83 : B   17 :  463
+   36 W : C    9  30  61 : B   25 :  676
+   37 Q : E    9  72  19 : B   19 :  477
+   38 I : E    7  85   8 : B   27 :  759
+   39 K : E    8  81  11 : E   20 :  508
+   40 R : E   10  55  36 : E   23 :  642
+   41 Q : C    7  19  73 : B   16 :  336
+   42 N : C    5   9  86 : B   20 :  517
+   43 G : C    5   6  88 : B   11 :  284
+   44 D : C    5   6  88 : B    8 :  191
+   45 D : C    6   9  85 : B   11 :  270
+   46 P : C    9  26  65 : B   11 :  268
+   47 L : E    8  71  21 : B   16 :  393
+   48 L : E    5  88   7 : B   24 :  698
+   49 T : E    5  90   5 : B   20 :  523
+   50 Y : E    5  90   5 : E   30 :  905
+   51 R : E    5  87   7 : B   19 :  496
+   52 F : E    8  70  22 : B   27 :  746
+   53 P : C    7  28  65 : B   18 :  505
+   54 P : C    5  13  82 : B   17 :  517
+   55 K : C    8  23  69 : B   14 :  511
+   56 F : E   11  59  30 : B   26 :  883
+   57 T : E    9  70  20 : B   18 :  600
+   58 L : C   10  43  47 : B   27 :  889
+   59 K : C    6  13  80 : B   14 :  482
+   60 A : C    4   7  89 : B   15 :  516
+   61 G : C    5   8  87 : B   13 :  468
+   62 Q : C    9  23  68 : E   20 :  608
+   63 V : E    9  69  22 : B   21 :  697
+   64 V : E    5  88   7 : E   35 : 1088
+   65 T : E    4  90   5 : E   30 :  895
+   66 I : E    5  91   5 : E   38 : 1136
+   67 W : E    5  88   6 : E   32 : 1041
+   68 A : E    8  75  17 : E   30 :  817
+   69 A : C   10  33  57 : B   21 :  559
+   70 G : C    7  11  82 : B   16 :  411
+   71 A : C    6   7  87 : B   18 :  408
+   72 G : C    6   7  88 : B   14 :  280
+   73 A : C    6   7  87 : B   18 :  362
+   74 T : C    7   8  86 : B   16 :  279
+   75 H : C    7   8  85 : B   18 :  346
+   76 S : C    7   9  84 : B   16 :  290
+   77 P : C    7   9  85 : B   19 :  459
+   78 P : C    6   9  84 : B   19 :  477
+   79 T : C    7  13  80 : B   18 :  368
+   80 D : C   10  34  56 : E   19 :  374
+   81 L : E    9  72  19 : B   27 :  720
+   82 V : E    7  84   9 : B   25 :  605
+   83 W : E    9  71  20 : B   27 :  659
+   84 K : C   10  31  60 : B   17 :  372
+   85 A : C    7  12  81 : B   18 :  423
+   86 Q : C    6   8  85 : B   17 :  394
+   87 N : C    6   7  87 : B   13 :  243
+   88 T : C    7   7  86 : B   18 :  567
+   89 W : C    8   9  84 : B   23 :  842
+   90 G : C    8   9  83 : B   22 :  701
+   91 C : C    7   8  85 : B   20 :  693
+   92 G : C    6   8  86 : B   20 :  707
+   93 N : C    6  10  84 : B   15 :  548
+   94 S : C    9  29  62 : B   20 :  746
+   95 L : E    8  73  19 : E   32 : 1143
+   96 R : E    5  89   7 : E   27 :  919
+   97 T : E    4  90   6 : E   31 : 1120
+   98 A : E    5  90   6 : E   26 :  976
+   99 L : E    5  88   7 : E   33 : 1329
+  100 I : E    8  73  20 : B   24 :  938
+  101 N : C    8  28  64 : B   19 :  764
+  102 S : C    6   9  85 : B   15 :  707
+  103 T : C    6   7  87 : B   11 :  600
+  104 G : C   11   9  81 : B   15 :  748
+  105 E : C   24  19  57 : E   19 :  825
+  106 E : E   34  40  26 : E   20 :  872
+  107 V : E   25  63  13 : B   22 :  936
+  108 A : E   12  80   8 : E   27 : 1185
+  109 M : E    7  86   7 : B   22 : 1042
+  110 R : E    6  86   7 : E   24 : 1219
+  111 K : E    8  79  13 : E   20 : 1021
+  112 L : E   11  47  43 : B   22 : 1241
+  113 V : C    9  23  68 : B   14 :  754
diff --git a/sample/d1ifra_.prof b/sample/d1ifra_.prof
new file mode 100644 (file)
index 0000000..67f6ac3
--- /dev/null
@@ -0,0 +1,122 @@
+
+Last position-specific scoring matrix computed, weighted observed percentages rounded down, information per position, and relative weight of gapless real matches to pseudocounts
+           A  R  N  D  C  Q  E  G  H  I  L  K  M  F  P  S  T  W  Y  V   A   R   N   D   C   Q   E   G   H   I   L   K   M   F   P   S   T   W   Y   V
+    1 G    0 -3 -1 -2 -3 -2 -3  6 -2 -4 -4 -2 -3 -4 -3 -1 -2 -3 -4 -4    0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0  1.17 0.08
+    2 S   -2 -1 -2 -2 -4  7 -1 -3 -2 -5 -4 -1 -3 -5 -3  3  1 -4 -4 -4    0   0   0   0   0  63   0   0   0   0   0   0   0   0   0  29   8   0   0   0  1.21 0.87
+    3 H    3  5 -2 -3 -4  0 -2 -1 -1 -4 -4  1 -3 -5 -1  2 -2 -5 -4 -4   30  36   0   0   0   4   0   3   1   0   0   6   0   0   3  16   0   0   0   0  0.71 0.87
+    4 R   -1  1 -1 -3 -3 -2 -2 -2 -3 -4 -4  0 -3 -5 -3  5  4 -5 -4 -3    2   8   2   0   0   0   1   1   0   0   0   4   0   0   0  58  24   0   0   0  0.89 0.89
+    5 T    5 -3 -1 -3 -1 -1 -3 -2 -3 -4 -4 -3 -3 -4 -1  4  1 -5 -4 -3   51   0   2   0   1   1   0   0   0   0   0   0   0   0   3  33   9   0   0   0  0.85 0.91
+    6 S   -1  1 -1 -3 -4 -2 -2 -3 -3 -2 -2  5 -3 -5 -3  3  2 -5 -4 -2    3   7   1   0   0   0   0   0   0   2   3  44   0   0   0  21  16   0   0   3  0.69 0.92
+    7 G   -2 -4 -3 -3 -5 -4 -4  7 -4 -6 -6 -4 -5 -1 -4 -1 -4 -4 -5 -5    0   0   0   0   0   0   0  95   0   0   0   0   0   3   0   2   0   0   0   0  1.86 0.92
+    8 R   -1 -1  4  1  2 -3  0 -3 -3 -4 -3 -2 -4 -4  5  1  0 -5 -4 -2    4   4  23   9   4   0   4   0   0   0   3   1   0   1  26  13   5   0   0   3  0.64 0.97
+    9 V   -3 -5 -5 -5  1 -5 -5 -6 -5  4  1 -5 -1 -3 -5 -4 -2 -5 -3  6    0   0   0   0   3   0   0   0   0  26   8   0   0   0   0   0   1   0   0  62  1.15 0.97
+   10 A    1 -2 -1 -3  2 -1  1 -1 -3 -3 -4  1 -3 -5 -3  5  2 -5 -4 -2   13   1   2   0   4   1   9   4   0   1   0   8   0   0   0  44  10   0   0   2  0.59 0.97
+   11 V   -3 -5 -5 -6 -3 -5 -5 -6 -5  7 -1 -5 -1  2 -5 -4 -3 -4 -3  3    0   0   0   0   0   0   0   0   0  73   0   0   0   9   0   0   0   0   0  18  1.34 0.97
+   12 E    2 -3  0  2  2  1  2 -2 -1 -1 -1  0  2 -4 -3  0  0 -4 -1 -1   17   0   4  10   4   6  17   3   1   2   5   6   6   0   0   5   6   0   2   5  0.23 0.95
+   13 E    0 -2 -2  2 -5  0  6 -4 -2 -5 -5 -2 -4 -5 -1  0 -3 -5 -2 -4    7   0   0   7   0   1  75   0   0   0   0   0   0   0   2   5   0   0   1   0  1.25 0.95
+   14 V    1 -4 -4 -5  6 -2 -4 -4 -5  3 -1 -4  0 -3 -4 -1  1 -5 -4  4   12   0   0   0  17   2   0   0   0  19   3   0   2   0   0   4   9   0   0  32  0.69 0.95
+   15 D   -2 -3  1  7  0 -1  0 -2 -3 -5 -5 -3 -5 -5 -4  2 -1 -6 -5 -5    2   0   6  65   2   2   1   2   0   0   0   0   0   0   0  17   2   0   0   0  1.24 0.97
+   16 E    0 -2 -2 -4  0  0 -1 -4  2 -1  1 -2  0 -4  5  0 -1 -5 -4  1    7   2   2   0   2   5   3   0   5   2  16   2   3   0  30   6   4   0   0  12  0.51 0.97
+   17 E   -3  0  1  5  0  1  4 -4  0 -5 -3  0 -4 -5 -4  1  0 -5 -4 -3    0   4   6  30   2   6  26   0   2   0   3   5   0   0   0  10   5   0   0   2  0.65 0.97
+   18 G   -2 -4 -2 -1 -5 -2 -2  7 -4 -6 -6 -2 -5 -5 -4 -2 -4 -5 -5 -5    1   0   0   2   0   2   3  90   0   0   0   2   0   0   0   0   0   0   0   0  1.73 0.97
+   19 K   -3  2  3 -1  1  0  0 -2 -1 -5 -3  6 -3 -3 -4 -1 -3 -5 -4 -4    0  11  13   2   3   3   5   2   1   0   3  53   0   1   0   2   0   0   0   0  0.84 0.96
+   20 F   -3 -4 -1 -5  0 -4 -5 -5 -2 -3 -2 -5 -3  7 -5 -2 -2  4  5 -3    2   0   4   0   3   0   0   0   0   0   0   0   0  58   0   3   2   4  24   0  1.43 0.96
+   21 V   -3 -5 -5 -5 -3 -5 -5 -6 -5  5 -1 -5  1 -3 -5 -4 -2 -5 -3  6    0   0   0   0   0   0   0   0   0  41   0   0   2   0   0   0   0   0   0  57  1.26 0.95
+   22 R   -1  5 -3 -3 -1  1  0 -4 -2  1 -1  3 -3 -4 -4 -2  0 -5 -4  1    5  30   0   0   2   5   7   0   1   7   4  17   0   0   0   2   7   0   0  12  0.48 0.95
+   23 L   -4 -4 -6 -6 -3 -4 -5 -6 -5  2  6 -5  1  0 -5 -3 -3 -4 -3  0    0   0   0   0   0   0   0   0   0  13  78   0   2   3   0   1   0   0   0   4  1.15 0.95
+   24 R   -1  0 -2 -1 -5  1  4 -4  3 -1 -1  2 -3 -1 -4 -1  0 -5 -2 -2    4   5   1   1   0   4  38   0   7   5   7  14   0   2   0   3   6   0   1   2  0.48 0.95
+   25 N   -4 -3  8 -1 -5 -2 -1 -3 -2 -5 -6 -2 -4 -5 -4 -1 -1 -6 -4 -5    0   0  94   0   0   0   3   0   0   0   0   0   0   0   0   0   3   0   0   0  1.88 0.95
+   26 K   -1 -2  4 -1 -4  0 -2 -3 -1  0 -4  3 -3 -5 -4  1  4 -5 -4 -3    3   0  25   3   0   3   0   0   1   7   0  19   0   0   0   9  30   0   0   0  0.64 0.95
+   27 S    0 -2 -2  1 -4 -3 -3  3  2 -5 -5 -1 -4 -5 -3  4  2 -5 -4 -4    6   1   0   9   0   0   0  21   4   0   0   2   0   0   0  41  14   0   0   0  0.70 1.03
+   28 N   -2  3  1  4 -4  0  2  0 -1 -4 -3  1 -3 -4 -3  0  0 -4 -4 -3    2  19   6  21   0   2  13   7   1   0   2   9   0   0   0   7   7   0   0   2  0.45 0.96
+   29 E   -3  1 -1 -1 -5  3  4 -4 -3 -5 -3  5 -3 -5 -3  1 -1 -5 -4 -3    0   5   2   2   0  13  24   0   0   0   3  38   0   0   0   9   3   0   0   1  0.78 1.05
+   30 D   -1 -1  1  6 -5 -2  4 -3 -3 -5 -5 -1 -4 -5 -1 -2  0 -5 -4 -4    4   3   4  49   0   0  26   0   0   0   1   3   0   0   2   0   5   0   0   0  1.01 0.96
+   31 Q   -3  1 -3 -2 -4  5  4  0  0  0 -2 -2  0 -1 -3 -2 -3 -4 -1  0    1   7   0   0   0  28  26   8   2   5   3   0   3   3   0   0   0   0   2   9  0.53 0.96
+   32 S    1 -3  2  2 -1 -1  0  0  0 -4 -2 -1 -3 -4  2  2  1 -5 -4 -2    9   0   9  12   1   2   7   8   3   0   3   3   0   0  12  16  10   0   0   3  0.29 0.96
+   33 M   -3 -4 -5 -5 -3 -4 -4 -5 -4  3  4 -2  5 -2  1 -4 -3 -4 -3  1    0   0   0   0   0   0   0   0   0  17  40   3  20   0   8   0   0   0   0   9  0.80 0.98
+   34 G   -1 -2 -2  0 -4 -3 -2  5  0 -4 -1  0 -3 -4 -4  1 -1 -4 -4 -2    3   2   0   5   0   0   2  53   3   0   8   5   0   0   0  11   4   0   0   2  0.75 0.98
+   35 N   -2 -3  3  1 -4 -3  0  5  0 -5 -5 -3 -4 -5 -3  2 -1 -4 -4 -4    1   0  14   7   0   0   5  50   3   0   1   0   0   0   0  14   3   0   0   0  0.87 0.95
+   36 W   -4 -4 -4 -5 -4 -4 -4 -4  2 -3  0 -4  1  3 -5 -4 -4 11  3 -4    1   0   0   0   0   0   0   1   6   0   9   0   4  11   0   0   0  57   7   0  2.08 0.95
+   37 Q   -3  1  0 -3  2  2  2 -1  1  0 -1  1  1  3 -3 -1  0 -3 -2  0    1   8   4   1   4  10  14   4   4   4   5   8   4  12   1   5   6   0   0   7  0.19 0.98
+   38 I   -3 -3 -4 -4 -3 -3 -4 -4 -4  3  4 -3  4 -2 -4  1 -2 -4 -3  2    1   1   1   1   0   0   1   1   0  16  39   1   9   0   1  12   1   0   0  16  0.63 0.98
+   39 K   -2  3  0 -1 -4  3 -1 -4 -3  1 -3  4 -1 -4  1 -2 -1 -5 -4  0    2  18   4   3   0  14   2   1   0   7   2  24   1   0   7   2   4   0   0   8  0.48 1.21
+   40 R   -3  7 -3 -4 -5  2 -2 -4  1 -4 -4  2 -3 -5  1 -3 -3 -5 -4 -2    1  64   0   0   0  10   0   1   3   0   1   8   0   0   7   1   0   0   0   3  1.30 1.21
+   41 Q   -3 -1  3 -1 -4  3  0 -4 -1 -1 -1  3  0 -4  1  0  1 -5 -4 -1    1   3  13   2   0  14   5   1   2   5   5  17   2   0   7   8  11   0   0   5  0.33 1.21
+   42 N    0 -4 -1 -4 -3 -3 -2 -4  1  4 -1 -4 -2  0  2 -2 -1 -4  1  4    7   1   3   1   0   0   3   1   3  22   5   1   0   3   9   2   2   0   5  32  0.52 1.17
+   43 G    0 -2  1  4 -5 -3 -1  3 -4 -4 -2 -2  0 -5  2 -1 -3 -5 -5 -3    9   2   7  28   0   0   4  24   0   0   5   2   3   0  11   2   0   0   0   2  0.58 1.22
+   44 D   -3 -4  2  4 -2 -3  1  3  0 -5 -3 -2 -4 -2  1  1 -2 -5 -4 -5    0   0   9  22   1   0  11  26   2   0   3   2   0   2   7  11   2   0   0   0  0.57 1.22
+   45 D    0  1  0  0 -4  0 -1  3 -1 -4 -1  2 -3 -1 -4  1 -1 -4 -4  0    6   7   3   5   0   4   3  23   1   0   7  13   0   3   0  13   3   0   0   6  0.27 1.21
+   46 P    0  2  0  1 -4  0  1 -1  1 -4 -3  2 -3 -4  3  1  0 -4 -4 -1    7  10   4   7   0   3  10   5   3   1   2  10   0   0  16  11   5   0   0   4  0.31 1.15
+   47 L   -1 -2 -2  3 -4  0  4 -4 -3  0 -2  0 -3 -4  1 -1  0 -4 -4  1    6   2   0  16   0   2  31   1   0   5   3   4   0   0   8   5   5   0   0  11  0.45 1.11
+   48 L    1 -4 -3 -4  1 -2  0 -4 -1  4  0 -1 -1  1 -2 -1  0 -4 -1  2   11   0   1   0   3   1   7   1   1  25   9   3   1   5   2   5   6   0   2  16  0.31 1.14
+   49 T    0  0  0 -3 -3 -3 -1 -3 -4  0 -1  0  0 -3 -4  2  3 -4 -4  3    8   5   5   0   0   0   5   2   0   3   6   5   3   1   0  14  16   0   0  24  0.30 1.15
+   50 Y   -4 -4 -4 -5 -4 -4 -4 -5 -2  0 -1 -3 -3  6 -5 -4 -4 -1  7 -2    1   0   0   0   0   0   0   1   0   5   3   2   0  36   0   1   0   0  46   2  1.51 1.15
+   51 R   -3  3  0 -3  2  1 -1 -4  3  0 -4  4 -1 -4 -3 -1  2 -4 -3 -1    1  13   4   0   4   5   3   1   6   7   1  32   2   0   0   4  13   0   0   4  0.53 1.15
+   52 F   -4 -4 -4 -5 -4 -4 -4 -5  3  2  2 -4 -2  7 -5 -4 -4 -2  1 -1    1   0   0   0   0   0   0   1   8  10  18   0   0  55   0   1   0   0   2   2  1.22 1.15
+   53 P   -2 -3  0 -2 -4 -3 -3 -3  2 -4 -2  0 -3 -4  6  1  3 -4 -3 -3    1   1   4   2   0   1   1   1   5   1   4   6   0   1  44  10  19   0   0   1  1.00 1.08
+   54 P    0  3 -2 -2  0 -2  1 -2  0 -4 -4  1 -4 -5  4  3 -2 -5 -4 -3    9  17   1   2   2   0   9   2   2   0   1   9   0   0  19  22   2   0   0   1  0.53 1.15
+   55 K   -3  2  2  2 -4 -1 -2  1  1 -1 -4  3 -4 -4 -1  1 -1  2 -4 -4    1  11  11  14   0   1   1  11   3   5   1  21   0   0   2  10   4   3   0   0  0.42 1.16
+   56 F   -1 -4 -4 -5  3 -2 -4 -4 -3  1  0 -4  0  6 -4 -1  1 -2  4 -1    5   0   0   0   6   2   0   0   0   6   8   0   2  34   0   5  11   0  14   3  0.73 1.17
+   57 T   -2 -1 -1 -1 -4 -1 -1 -3  0  2 -1  2 -2 -4 -4 -1  1 -5 -4  4    1   2   3   3   0   3   5   2   3  13   5  15   0   0   0   5   9   0   0  30  0.37 1.18
+   58 L   -4 -4 -5 -5 -4 -4 -5 -5 -5  3  5 -4  3  0 -5 -4  0 -4 -3  0    0   0   0   0   0   0   0   0   0  14  65   0   6   3   0   0   5   0   0   3  1.02 1.18
+   59 K    0  2  2  1  1  1  1  0  0 -5 -3  4 -4 -5  1 -1 -3 -5 -4 -4    6  10   8   8   3   7   8   6   2   0   2  27   0   0   6   4   0   0   0   0  0.44 1.18
+   60 A    4 -1 -2 -4 -4 -1 -3  0 -4 -4 -4  0 -4 -5  5  0 -1 -5 -4 -3   39   2   2   0   0   2   0   7   0   0   0   5   0   0  29   7   4   0   0   0  0.85 1.18
+   61 G   -3  0  3 -2 -3  1 -2  5  4 -5 -4 -2 -3 -4 -4  0 -3 -5 -4 -4    0   4  15   1   1   6   1  48  12   0   1   1   1   1   0   5   0   0   0   1  0.91 1.18
+   62 Q    1  1 -3 -3 -1  5 -1  0  2 -4 -4  3 -1 -5 -1  0  0 -5 -4 -4   13   8   0   0   1  27   1   9   5   0   0  16   2   0   3   8   5   0   0   0  0.52 1.18
+   63 V   -2  0  0 -3 -4  0  0 -4  3 -3 -3  3  0  0 -3  1  4 -4  1  0    1   4   3   0   0   5   5   1   8   0   1  19   3   3   0  10  26   0   5   6  0.44 1.15
+   64 V   -1 -4 -4 -5  0 -4 -4  0 -4  3  1 -4  1  0 -4 -4 -3 -4  2  5    4   0   0   0   2   0   0   8   0  13  11   0   3   4   0   1   0   0   7  44  0.66 1.15
+   65 T    0 -1 -2 -3 -4 -2 -3 -4 -4 -3 -4  4 -1 -4 -3 -1  6 -5 -4 -2    5   3   1   0   0   0   0   0   0   0   0  28   2   0   0   0  56   0   0   3  1.03 1.18
+   66 I   -3 -5 -6 -6 -4 -5 -6 -4 -6  6  0 -5 -1 -1 -5 -5 -3 -5 -4  5    0   0   0   0   0   0   0   1   0  56   5   0   0   2   0   0   0   0   0  36  1.33 1.22
+   67 W   -4 -3 -6 -5 -5 -4 -5 -5 -4 -5 -4 -5 -4  1 -2 -5 -5 12  3 -5    1   1   0   1   0   0   0   0   0   0   0   0   0   4   2   0   0  80  10   0  3.18 1.18
+   68 A    5 -1 -3 -4 -3 -3 -3  1 -4 -3 -4 -2 -3 -5 -3  3  0 -5 -4 -1   55   3   0   0   0   0   0  10   0   1   0   2   0   0   0  19   4   0   0   5  0.81 1.15
+   69 A    4  3 -2 -1 -2  1 -1 -3 -3 -4 -4  3 -3 -5 -3  1 -1 -5 -4 -2   36  17   2   4   1   5   2   0   0   0   1  17   0   0   0  10   4   0   0   3  0.57 1.15
+   70 G    0 -3  2  3 -5 -3 -2  5 -4 -5 -5 -2 -5 -3 -4  0 -3 -5 -5 -3    8   1  10  20   0   0   2  48   0   0   0   2   0   1   0   7   0   0   0   2  0.92 1.17
+   71 A    4 -2  0 -4 -3  1 -2  0 -1 -2 -2 -1 -3  0 -4  2  0 -5 -4 -2   46   1   4   0   0   8   1   6   2   2   3   3   0   4   0  16   4   0   0   1  0.55 1.17
+   72 G   -3  0  0 -1 -5 -1  1  5 -3 -5 -5  3 -4 -5 -4 -3 -3 -5 -5 -2    0   5   3   3   0   1   9  53   0   0   0  18   0   0   0   0   0   0   0   4  0.93 1.13
+   73 A    3 -1 -2  1 -4 -3 -2  1 -1 -2 -3 -1 -1 -4  3 -2 -1 -5 -1  2   28   3   2   7   0   0   1  12   1   1   0   4   2   0  13   0   3   0   3  18  0.39 1.14
+   74 T    1  0 -3 -1 -1  1  0 -3 -1  1 -2  1 -1 -4 -2  2  1 -5 -4  2   14   4   0   3   1   6   7   0   1   7   3   9   1   0   1  18  10   0   0  13  0.25 1.14
+   75 H    0 -1  1  0 -1  2 -2  0  8 -4 -4 -2 -3 -4  0  0 -3 -4  0 -4   10   3   7   4   1   9   1   8  40   0   1   2   0   0   5   5   1   0   2   1  0.89 1.10
+   76 S    1 -3  3  0 -1  1  0 -2 -1 -4 -3  1 -4 -5 -3  4  0 -5 -4 -3   10   0  15   5   1   6   6   3   1   0   2   8   0   0   0  34   6   0   0   2  0.50 1.14
+   77 P    0 -1 -2 -1 -4 -2 -3 -3 -4 -1 -3 -1 -3 -2  7  0 -1 -4 -4 -3    8   3   2   3   0   1   1   2   0   4   3   2   0   2  56   8   4   0   0   1  1.19 1.07
+   78 P    0 -1 -1  1 -4 -3 -2 -3 -4 -4 -4 -2 -4 -5  7 -1 -3 -5 -4 -4    8   3   3   8   0   0   2   2   0   0   1   2   0   0  66   3   0   0   0   1  1.58 1.09
+   79 T    0 -3  3  1 -4 -1  0 -1 -3 -4 -4 -2 -1 -3 -3  4  3 -5 -4 -3    8   0  14   9   0   2   6   4   0   0   1   1   2   1   0  29  22   0   0   0  0.56 1.11
+   80 D   -3 -3  2  6 -5  1  1 -3 -3 -3 -5 -1 -4 -5 -3  0  0 -5 -4 -1    1   0   7  55   0   7   9   0   0   1   1   2   0   0   0   5   6   0   0   4  1.02 1.11
+   81 L   -3 -4 -2 -3  1  1 -4 -3 -4  2  5 -4  0  2 -5 -4 -3 -4  0  0    0   0   3   2   3   6   0   3   0  14  52   0   1   8   0   0   0   0   2   4  0.69 1.13
+   82 V   -3 -4 -2 -1 -3 -3  2 -5 -4  2  1 -4 -2 -3 -4 -3 -1 -5 -4  5    0   0   2   4   0   0  14   0   0  12  10   0   0   0   0   0   4   0   0  52  0.77 1.13
+   83 W    0 -4 -4 -5  2 -4 -4 -3 -4 -2  0 -4  5  3 -5 -1 -3  9  0  0    7   0   0   0   4   0   0   2   0   1   6   0  18  14   0   6   0  30   3   6  1.14 1.13
+   84 K   -3  2 -2  3 -5  1  1  0 -3 -5 -4  5 -4 -5 -3  0 -3 -5 -4 -4    1   8   0  16   0   5   9   6   0   0   1  43   0   0   0   8   0   0   0   0  0.76 1.10
+   85 A    0 -3  3 -1 -4 -2  1  2 -1 -1 -2 -1 -3 -1 -3  3  1 -4 -4 -2    7   0  18   2   0   0   8  17   1   4   3   3   0   3   0  23   8   0   0   2  0.39 1.11
+   86 Q   -2 -1 -1 -1 -1  6  2 -3  4 -1 -2 -1  0 -4 -1 -2 -1 -3 -3  0    2   1   2   2   1  44  12   1  11   4   3   1   2   1   2   1   2   0   0   6  0.76 1.01
+   87 N    0  0  3  3 -5  0  2 -3 -1 -5 -5  2 -4  0  1  2 -1 -5 -4 -3    7   5  13  14   0   4  11   1   1   0   0  14   0   5   7  14   2   0   0   2  0.38 1.15
+   88 T   -1 -1  2  0 -3 -1 -2 -3  0 -4 -3  0 -3 -4 -1  5  2 -4 -1 -3    3   2   9   5   0   2   1   1   2   1   2   6   0   0   2  44  15   0   3   1  0.59 1.05
+   89 W   -5 -3 -6 -6 -5 -4 -5 -5 -4 -4 -2 -5 -1  5 -6 -5 -5 12  0 -4    0   2   0   0   0   0   0   0   0   0   2   0   1  23   0   0   0  70   0   0  2.85 1.15
+   90 G   -1  0 -3 -4 -5 -1 -4  6 -1 -3 -5 -3 -4 -2  0 -2 -1 -4 -1 -4    2   5   0   0   0   2   0  71   1   2   0   1   0   2   4   1   3   0   3   1  1.21 1.15
+   91 C   -1 -3 -3 -4  0  0 -3 -4 -2  2 -2 -2  0 -1  1  1  4 -4 -2  2    4   0   0   0   2   5   0   0   1  11   3   1   2   2   7  12  31   0   2  16  0.45 1.12
+   92 G   -1 -4 -1 -4 -4 -2 -4  7 -4 -3 -5 -4 -4 -1 -4 -1 -2 -5 -5 -2    4   0   2   0   0   2   0  79   0   1   0   0   0   3   0   4   1   0   0   3  1.46 1.15
+   93 N    1 -1  1  3 -4  0  2 -1 -3 -5 -5  0 -2 -3  1  2  1 -5 -4 -4   12   3   7  20   0   3  13   5   0   0   0   4   1   1   7  15   9   0   0   0  0.42 1.17
+   94 S   -2 -2  5  3  0  0  1 -3  3 -3 -3 -2 -4 -4 -4  2 -2 -5 -4 -2    2   2  33  16   2   4   8   1   7   2   2   0   0   0   0  18   0   0   0   2  0.69 1.10
+   95 L   -2 -5 -5 -2  5 -4 -5 -5 -5  4  0 -5  3  0 -2 -2  1 -5 -4  4    2   0   0   2  12   0   0   0   0  28   4   0   8   4   2   3   8   0   0  26  0.73 1.19
+   96 R   -3  3 -3 -4 -4  2  0 -4  0  0 -2  2  0 -3 -4 -1  3  1 -1  2    0  18   0   0   0   9   5   1   2   5   2  12   2   1   0   3  18   2   2  17  0.40 1.19
+   97 T    0 -4 -2 -4 -3 -3 -4 -4 -4  1 -3 -3 -3 -4 -4  0  6  2 -4  1    5   0   1   0   0   0   0   0   0   9   0   0   0   0   0   3  66   3   0  11  1.11 1.17
+   98 A    0 -1 -4 -4 -4 -1 -4 -3 -2  4  0  1  1 -1 -4  1  3 -5 -2  2    8   3   0   0   0   2   0   2   1  25   6   8   3   3   0  10  17   0   1  11  0.37 1.17
+   99 L   -4 -4 -5 -6 -4 -4 -5 -6 -5 -1  6 -5  0 -2 -5 -4 -2 -4 -3 -2    0   0   0   0   0   0   0   0   0   0  94   0   0   0   0   0   3   0   0   0  1.49 1.14
+  100 I   -2 -2 -4 -5  2 -1 -2 -5  0  2  3 -1  0  1 -5 -2 -1 -4  2  3    2   2   0   0   5   3   2   0   3  12  25   4   2   5   0   2   3   0   9  21  0.42 1.17
+  101 N   -4 -2  7  3 -5 -2 -2 -3 -2 -5 -6  0 -5 -5 -4  0  0 -6 -5 -5    0   1  64  19   0   0   0   0   0   0   0   5   0   0   0   6   4   0   0   0  1.41 1.17
+  102 S    2 -2  0 -2 -4  0  2 -1 -3 -5 -3  0 -4 -5  4  2  0 -5 -4 -4   20   1   4   2   0   3  13   4   0   0   2   5   0   0  21  19   5   0   0   0  0.55 1.17
+  103 T   -1 -1  3  3 -5  2  3 -2  1 -5 -3  0 -4 -5 -4  2 -1 -5 -4 -4    4   2  14  17   0  10  17   2   3   0   3   5   0   0   0  19   4   0   0   0  0.53 1.17
+  104 G   -2 -2  0 -3 -5 -4 -3  7 -4 -6 -6 -2 -5 -5 -4 -1 -4 -5 -5 -5    1   2   4   0   0   0   1  85   0   0   0   2   0   0   0   3   0   0   0   0  1.70 1.17
+  105 E   -3  0  1  1 -6  2  6 -4 -3 -2 -5 -2 -4 -5 -4 -3 -3 -5 -4 -3    0   4   7   5   0   7  71   0   0   3   0   0   0   0   0   0   0   0   0   2  1.29 1.17
+  106 E   -1 -3 -1  3 -5 -1  6 -4 -3 -1 -4 -2 -4 -5 -4 -3 -1 -6 -5  1    5   0   2  15   0   0  60   0   0   3   0   1   0   0   0   0   3   0   0  12  1.05 1.17
+  107 V   -3  3 -4 -5  2 -3 -3 -5 -4  0  0  3  4 -4 -5 -3 -2 -5 -4  4    0  20   0   0   4   0   0   0   0   3   7  21  12   0   0   0   2   0   0  31  0.71 1.14
+  108 A    6 -4 -4 -4 -3 -3 -2 -1 -4 -4 -4 -3 -3 -5 -3  1 -2 -5 -4 -3   88   0   0   0   0   0   2   1   0   0   0   0   0   0   0   9   0   0   0   0  1.39 1.14
+  109 M   -2 -2 -3 -3 -4  0  2 -4 -3 -3 -3  0  3 -4 -4  3  5 -5 -4  0    0   1   0   0   0   4  16   0   0   0   0   5  10   0   0  21  35   0   0   8  0.68 1.10
+  110 R   -4  5 -2 -4 -5  0 -2 -5  8 -2 -2  0 -3 -1 -4 -3 -4 -4  1 -4    0  34   0   0   0   3   0   0  47   4   3   4   0   2   0   0   0   0   3   0  1.35 0.99
+  111 K   -2 -3 -3 -3  1  0 -2 -4 -4  3 -3  1 -2 -4 -4  0  5 -4 -1 -2    0   0   0   0   3   4   2   0   0  20   0  11   0   0   0   7  51   0   2   0  0.74 0.91
+  112 L    0 -4 -4 -5 -3 -4 -4 -4 -4  3  2 -4 -1 -2 -4 -3  2 -4 -3  4    7   0   0   0   0   0   0   0   0  16  24   0   0   0   0   0  15   0   0  38  0.62 0.68
+  113 V   -2 -4 -4 -4 -2 -3 -4 -5 -4  4  0 -4  2 -2 -4 -3 -1 -4 -2  5    0   0   0   0   0   0   0   0   0  24   0   0   6   0   0   0   0   0   0  70  0.83 0.42
+
+                      K         Lambda
+Standard Ungapped    0.1300     0.3139
+Standard Gapped      0.0410     0.2670
+PSI Ungapped         0.1824     0.3176
+PSI Gapped           0.0558     0.2670
diff --git a/sample/d3nul__.out b/sample/d3nul__.out
new file mode 100644 (file)
index 0000000..b870ce3
--- /dev/null
@@ -0,0 +1,147 @@
+>prediction for: sample/d3nul__.prof
+
+#                  *         *         *         *         *         *
+AA:       SWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFLA
+SS:       CCHHHHHHHHHCCCCCCCCHEEEEECCCCCEEEECCCCCCCCHHHHHHHHHCCCCCCCCC
+CN:       BBBBBBEBBEBBBBBBBBEEEEEEEEEEEEEEEEEBBBBBEEBBEBBBEEBEBBBBBBBB
+#                  *         *         *         *         *         *
+AA:       PTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVER
+SS:       CCEEEECCCEEEEEECCCCEEEEECCCCCEEEEEECCCEEEEEEECCCCCCHHHHHHHHH
+CN:       EBEEBEBBEEEEEEEBBBBBBEEEEEBBBEEEEEEEEEEEEEEEBBBBBBBBEEEBEEEB
+#                  *
+AA:       LGDYLIESEL
+SS:       HHHHHHHCCC
+CN:       EEEBEBBBBB
+//
+
+>#   AA : SS P_H P_E P_C : CN     : RWCO
+    1 S : C   11   7  82 : B   14 :  840
+    2 W : C   23  10  67 : B   22 : 1221
+    3 Q : H   59  11  30 : B   18 :  864
+    4 S : H   79   8  12 : B   18 :  860
+    5 Y : H   86   6   7 : B   25 : 1199
+    6 V : H   89   5   6 : B   27 : 1276
+    7 D : H   90   5   6 : E   21 :  855
+    8 D : H   90   4   6 : B   17 :  728
+    9 H : H   89   5   6 : B   22 :  954
+   10 L : H   85   6   8 : E   30 : 1188
+   11 M : H   72   9  18 : B   24 :  850
+   12 C : C   44  11  46 : B   22 :  826
+   13 D : C   18   8  73 : B   18 :  669
+   14 V : C   10   7  83 : B   22 :  751
+   15 E : C    8   6  86 : B   17 :  593
+   16 G : C    8   7  85 : B   18 :  640
+   17 N : C   10   8  82 : B   17 :  696
+   18 H : C   16  11  73 : B   24 :  808
+   19 L : C   30  16  54 : E   32 : 1103
+   20 T : H   45  22  32 : E   26 :  962
+   21 A : E   37  43  20 : E   27 : 1017
+   22 A : E   15  75  10 : E   37 : 1265
+   23 A : E    7  88   5 : E   38 : 1286
+   24 I : E    6  89   5 : E   41 : 1341
+   25 L : E    8  79  13 : E   36 : 1172
+   26 G : C   11  43  46 : E   29 :  932
+   27 Q : C    8  15  77 : E   25 :  737
+   28 D : C    7   9  84 : E   20 :  532
+   29 G : C    7  10  83 : E   25 :  624
+   30 S : C   11  23  66 : E   25 :  603
+   31 V : E   17  55  28 : E   29 :  740
+   32 W : E   17  70  13 : E   30 :  854
+   33 A : E   14  69  17 : E   32 :  709
+   34 Q : E   12  46  42 : E   26 :  578
+   35 S : C    9  15  76 : E   23 :  591
+   36 A : C    7   8  86 : B   17 :  423
+   37 K : C    7   7  86 : B   15 :  271
+   38 F : C    7   7  85 : B   25 :  614
+   39 P : C    8   8  84 : B   18 :  409
+   40 Q : C    9   8  83 : B   16 :  291
+   41 L : C   12   9  80 : E   28 :  661
+   42 K : C   27  11  63 : E   19 :  322
+   43 P : H   63  10  27 : B   19 :  426
+   44 Q : H   81   7  12 : B   15 :  276
+   45 E : H   86   6   8 : E   23 :  512
+   46 I : H   89   5   6 : B   28 :  712
+   47 D : H   90   5   5 : B   19 :  363
+   48 G : H   89   5   6 : B   22 :  366
+   49 I : H   87   6   7 : E   35 :  870
+   50 K : H   83   8   9 : E   26 :  634
+   51 K : H   69  10  21 : B   16 :  411
+   52 D : C   33  10  56 : E   22 :  600
+   53 F : C   12   7  80 : B   24 :  590
+   54 E : C    8   7  85 : B   12 :  285
+   55 E : C    8   7  85 : B   13 :  247
+   56 P : C    8   7  85 : B   17 :  432
+   57 G : C    8   7  84 : B   14 :  348
+   58 F : C    8   9  83 : B   18 :  411
+   59 L : C    8  10  82 : B   28 :  724
+   60 A : C    8  10  83 : B   25 :  638
+   61 P : C    7  10  83 : E   21 :  586
+   62 T : C    8  17  75 : B   21 :  643
+   63 G : E   10  50  39 : E   28 :  826
+   64 L : E    7  80  12 : E   36 : 1037
+   65 F : E    6  87   7 : B   28 :  769
+   66 L : E    8  78  14 : E   33 :  906
+   67 G : C    9  45  46 : B   22 :  638
+   68 G : C    7  20  73 : B   18 :  419
+   69 E : C    8  24  68 : E   20 :  522
+   70 K : E   10  55  36 : E   20 :  620
+   71 Y : E    7  81  12 : E   29 :  815
+   72 M : E    5  89   6 : E   28 :  795
+   73 V : E    4  91   5 : E   31 :  897
+   74 I : E    5  88   7 : E   33 :  937
+   75 Q : E    8  71  20 : E   23 :  614
+   76 G : C    9  27  64 : B   21 :  595
+   77 E : C    6   9  85 : B   16 :  399
+   78 Q : C    6   7  87 : B   15 :  424
+   79 G : C    8  15  77 : B   18 :  391
+   80 A : E   11  48  41 : B   22 :  504
+   81 V : E    8  81  11 : B   27 :  647
+   82 I : E    6  89   6 : E   32 :  767
+   83 R : E    7  87   7 : E   28 :  621
+   84 G : E   10  70  20 : E   25 :  585
+   85 K : C   10  31  58 : E   21 :  438
+   86 K : C    6  11  83 : E   19 :  368
+   87 G : C    5   7  88 : B   14 :  206
+   88 P : C    6   9  85 : B   13 :  306
+   89 G : C    9  25  66 : B   22 :  574
+   90 G : E    8  69  23 : E   29 :  767
+   91 V : E    5  89   6 : E   38 : 1061
+   92 T : E    4  92   4 : E   37 : 1029
+   93 I : E    4  91   4 : E   40 : 1159
+   94 K : E    6  87   6 : E   30 :  896
+   95 K : E    9  71  20 : E   26 :  812
+   96 T : C    9  29  62 : E   29 :  951
+   97 N : C    7  16  77 : E   23 :  743
+   98 Q : C    9  33  58 : E   28 :  958
+   99 A : E    8  71  21 : E   37 : 1335
+  100 L : E    5  87   8 : E   39 : 1504
+  101 V : E    4  90   6 : E   41 : 1572
+  102 F : E    4  90   5 : E   39 : 1520
+  103 G : E    5  89   6 : E   39 : 1529
+  104 F : E    7  82  11 : E   32 : 1326
+  105 Y : E   11  52  37 : B   27 : 1051
+  106 D : C    9  17  74 : B   15 :  582
+  107 E : C    7   8  85 : B   17 :  667
+  108 P : C    7   7  86 : B   17 :  607
+  109 M : C    8   8  84 : B   22 :  811
+  110 T : C   11   8  81 : B   20 :  697
+  111 G : C   20   9  71 : B   21 :  765
+  112 G : H   46  10  44 : B   20 :  785
+  113 Q : H   74   9  17 : E   22 :  771
+  114 C : H   84   7   9 : E   33 : 1120
+  115 N : H   88   6   6 : E   26 :  863
+  116 L : H   90   5   5 : B   22 :  803
+  117 V : H   90   5   5 : E   29 : 1140
+  118 V : H   90   5   5 : E   35 : 1398
+  119 E : H   91   4   5 : E   23 :  935
+  120 R : H   90   4   5 : B   21 :  857
+  121 L : H   90   5   5 : E   35 : 1494
+  122 G : H   90   5   5 : E   31 : 1269
+  123 D : H   89   5   6 : E   19 :  789
+  124 Y : H   89   5   6 : B   23 :  963
+  125 L : H   87   6   7 : E   30 : 1271
+  126 I : H   82   8  10 : B   18 :  776
+  127 E : H   65  11  25 : B   11 :  537
+  128 S : C   27  10  63 : B   15 :  755
+  129 E : C   10   7  83 : B   11 :  615
+  130 L : C    7   6  87 : B   14 :  798
diff --git a/sample/d3nul__.prof b/sample/d3nul__.prof
new file mode 100644 (file)
index 0000000..7e3a407
--- /dev/null
@@ -0,0 +1,139 @@
+
+Last position-specific scoring matrix computed, weighted observed percentages rounded down, information per position, and relative weight of gapless real matches to pseudocounts
+           A  R  N  D  C  Q  E  G  H  I  L  K  M  F  P  S  T  W  Y  V   A   R   N   D   C   Q   E   G   H   I   L   K   M   F   P   S   T   W   Y   V
+    1 S    0 -3 -1 -2 -3 -2 -2 -2 -3 -4 -4 -2 -3 -4 -3  6  2 -5 -4 -3    2   0   0   0   0   0   0   0   0   0   0   0   0   0   0  88  10   0   0   0  1.25 0.83
+    2 W   -5 -5 -6 -7 -5 -4 -5 -5 -5 -5 -4 -5 -4 -1 -6 -5 -5 13  0 -5    0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0  3.98 1.03
+    3 Q   -2 -2  2  2 -5  7  0 -4 -2 -5 -5  0 -3 -6 -4 -1 -1 -5 -4 -5    1   0   8  14   0  65   3   0   0   0   0   3   0   0   0   3   2   0   0   0  1.29 1.06
+    4 S    3 -3 -2  3 -4  0 -1  1 -4 -4 -4 -3 -4 -5 -1  2  2 -5 -2 -2   32   0   0  15   0   5   2   9   0   0   0   0   0   0   2  16  15   0   2   1  0.53 1.06
+    5 Y   -4 -4 -5 -6  2 -4 -5 -5 -1 -2 -1 -4  0  1 -5 -4 -4  0  9 -3    0   0   0   0   5   0   0   0   0   2   4   0   3   2   0   0   0   0  84   0  2.00 1.06
+    6 V   -3 -5 -5 -5 -3 -5 -5 -5 -5  4  0 -5 -1 -3 -5 -4  0 -5 -4  6    0   0   0   0   0   0   0   0   0  23   7   0   0   0   0   0   5   0   0  65  1.18 1.06
+    7 D   -3 -3  0  7 -5 -2 -1 -3 -3 -5 -5  2 -4 -5 -3 -1  0 -5 -5 -4    0   0   2  72   0   0   0   0   0   0   0  12   0   0   0   4   7   0   0   0  1.38 1.00
+    8 D   -1 -1  4  3 -4  1  2 -3 -2 -4 -2 -1 -3 -4 -3  1  1 -5 -4 -2    4   2  24  19   0   5  17   0   0   0   4   2   0   0   0  11   8   0   0   3  0.55 0.99
+    9 H   -2 -1  2 -2 -3  2 -1 -3  6 -3  1 -2  1  1 -3  1 -2  2  1 -1    1   2  10   1   0   8   3   1  23   1  14   1   4   5   1  13   1   3   4   4  0.45 0.91
+   10 L   -2 -4 -4 -5 -3 -4 -4 -5 -4  0  6 -2  0  0 -4 -4 -1 -3 -3  0    2   0   0   0   0   0   1   1   0   3  79   2   0   2   0   1   4   0   0   3  1.05 0.99
+   11 M    1  0 -2 -2  0  0 -2 -1 -2 -1  1 -1  7 -2 -2 -1  0 -2 -2  0   11   5   1   2   2   4   2   4   1   2  11   3  34   1   2   4   6   0   1   4  0.48 0.74
+   12 C    2 -2 -2  0  8  1 -2 -2 -2 -2 -1 -1 -2 -2 -2  0  0 -2 -2 -2   20   2   2   5  33   6   2   2   1   2   5   3   1   1   2   6   5   0   1   3  0.69 0.72
+   13 D   -1 -2  0  4 -2 -1  2 -2 -2 -1  0 -1 -2 -1  0  0  0 -2 -2 -2    5   2   4  28   1   2  16   3   1   4   8   2   1   3   5   5   6   1   1   3  0.32 0.65
+   14 V   -1 -3 -3 -3 -2 -1 -2 -1 -3  5 -1 -2  2 -1 -1  0 -2 -3 -2  3    3   1   1   1   1   3   2   6   1  35   4   2   5   2   3   7   2   0   1  20  0.45 0.82
+   15 E    0 -1 -2  2 -3 -2  2  4 -2 -3 -3 -1 -3 -3 -2  2 -2 -3 -3 -3    7   4   1  13   0   1  12  34   1   1   2   3   1   1   1  15   1   0   1   2  0.49 0.85
+   16 G   -1 -3  0 -1 -1 -3 -1  4 -3 -3 -4 -3 -3 -4 -1  2  4 -4 -3 -3    3   1   3   2   1   1   3  32   0   1   1   1   0   1   3  18  28   0   0   1  0.66 0.97
+   17 N   -1 -1  2 -2 -4  3 -2  4  3 -5 -3  2 -2 -5 -2  0 -1 -5 -4 -4    4   2   8   1   0  15   0  36   7   0   2  12   1   0   2   6   4   0   0   0  0.61 1.07
+   18 H   -2  1  0 -4  6  2 -3 -2  7 -4 -3  2 -3 -1 -4 -2 -1 -4  1 -4    3   6   4   0  18   8   0   2  31   0   2  13   0   3   0   2   3   0   4   0  0.88 1.10
+   19 L   -2 -4 -5 -5  4  0 -4 -2 -5  3  2 -4  1 -1 -4 -1 -3 -5 -4  4    2   0   0   0   9   6   0   4   0  17  22   0   3   3   0   4   0   0   0  30  0.60 1.12
+   20 T   -1 -3  0  5  0  1  1 -4  1 -2 -5  0 -1 -5 -4  1  3 -5 -4 -4    5   0   2  35   2   7   9   0   3   2   0   6   2   0   0   9  17   0   0   0  0.65 1.12
+   21 A    3  1  1  0 -4  0  1  0 -2 -5 -5  3 -2 -5 -4  2 -2 -5 -1 -4   24   7   6   5   0   4   8   6   1   0   0  17   1   0   0  19   0   0   2   0  0.44 1.12
+   22 A    6 -4 -4 -4  3 -2 -3  2 -4 -4 -4 -3 -3 -5 -4 -1 -3 -5 -4 -1   75   0   0   0   6   2   0  12   0   0   0   0   0   0   0   1   0   0   0   4  1.17 1.13
+   23 A    6 -4 -4 -5  3 -4 -4  0 -4  1 -2 -4 -3 -4 -4 -2 -2 -5 -2  0   70   0   0   0   6   0   0   5   0   9   3   0   0   0   0   0   1   0   1   5  0.99 1.14
+   24 I   -2 -5 -6 -6 -4 -5 -6 -6 -6  7  1 -5 -1 -3 -5 -5 -3 -5 -4  2    2   0   0   0   0   0   0   0   0  79  12   0   0   0   0   0   0   0   0   7  1.47 1.14
+   25 L   -1 -5 -5 -5  3 -4 -5 -1 -5  4  2 -5  0  0 -5 -3 -2  2  1  3    4   0   0   0   6   0   0   5   0  30  21   0   2   4   0   1   1   2   6  18  0.62 1.12
+   26 G   -2 -2 -1 -3 -2 -4 -4  6 -4 -5 -5 -1 -4 -3 -4  1 -3 -5 -1 -3    0   2   2   0   1   0   0  70   0   0   0   4   0   1   0  13   0   0   3   2  1.27 1.12
+   27 Q    1  1  0 -4 -1  1 -3 -4  6 -1  1  0  0 -1 -3 -2  0 -4  2 -3   12   8   5   0   1   7   0   0  19   4  17   5   2   2   1   2   7   0   8   0  0.40 1.14
+   28 D    0 -3  0  7 -5  1  1 -4 -3 -5 -6  0 -5 -6 -1 -1 -3 -6 -5 -5   10   0   3  63   0   6   6   0   0   0   0   6   0   0   2   4   0   0   0   0  1.21 1.14
+   29 G    0 -1 -3  0 -1 -3 -1  6 -4 -3 -5 -3 -5 -3  0 -1 -2 -5 -5 -5    7   4   0   6   2   1   4  64   0   2   0   0   0   2   5   2   2   0   0   0  1.07 1.14
+   30 S    1 -3  2 -3  0 -1 -1  1 -3 -5 -5  1 -4 -5 -2  4  1  1 -4 -4    9   0  11   0   2   2   2  11   0   0   0   8   0   0   2  42   9   2   0   0  0.62 1.14
+   31 V   -1 -5 -5 -2 -4 -4 -1 -5 -5  2  0 -4 -1 -1 -3 -2  0 -5  0  5    5   0   0   2   0   0   4   0   0  10   8   0   1   2   1   2   6   0   3  56  0.76 1.15
+   32 W   -5 -3 -2 -6  2 -4 -3 -5 -5 -3 -2 -5 -4 -2 -6 -5 -5 12  1 -5    0   1   2   0   5   0   1   0   0   2   3   0   0   0   0   0   0  83   2   0  3.18 1.15
+   33 A    6 -4 -4 -4 -3 -3 -3  1 -4 -3 -3 -3 -3 -5 -3 -1  0 -5 -4 -1   82   0   0   0   0   0   0   7   0   0   1   0   0   0   0   1   4   0   0   4  1.24 1.15
+   34 Q    3  1 -2 -3  0  4 -2 -1 -1 -4 -4  1 -3 -4 -4  2  2 -4  0 -1   22   7   1   0   2  20   0   4   1   0   0   7   0   0   0  14  13   0   4   4  0.44 1.13
+   35 S    0 -1 -1 -3 -3 -2 -1 -1  1 -4 -4 -2 -4 -5 -3  5  2 -5 -4 -2    5   3   2   0   0   0   2   5   3   0   0   2   0   0   0  61  14   0   0   3  0.89 1.13
+   36 A    3 -4 -1  1 -4 -3  1  2 -4 -5 -3 -3 -4 -5  4  2 -1 -5 -5 -3   27   0   2   8   0   0   9  16   0   0   2   0   0   0  18  15   2   0   0   2  0.57 1.17
+   37 K   -1 -4  4  1 -5 -3 -2  5  1 -5 -6 -1 -5 -5 -4  0  1 -5 -5 -5    4   0  20   8   0   0   2  43   4   0   0   3   0   0   0   7   9   0   0   0  0.85 1.17
+   38 F   -1 -5 -2 -2  2 -2 -5 -5 -4 -1  1 -5 -2  7 -2 -4 -4  1  2 -3    5   0   2   3   5   2   0   0   0   2  15   0   0  58   2   0   0   2   4   0  1.14 1.15
+   39 P    1 -2  2 -2  0  1 -2 -2 -2 -1  0 -1 -2 -1  4  0  0 -3  0 -1   12   1   9   2   2   7   2   2   1   3   9   4   1   3  19   8   6   0   3   5  0.25 0.84
+   40 Q    0 -2  3  0 -4  4  1 -3  0 -2 -4  1 -3 -4  1  0  1 -4 -3  0    9   0  13   4   0  20   6   1   2   2   1   9   0   0   6   8   9   0   0   8  0.35 1.08
+   41 L   -2 -4 -5 -5 -2 -4 -5 -5 -4  4  3 -4  2  3 -4 -2 -2 -4 -2  3    2   0   0   0   1   0   0   0   0  27  25   0   5  13   0   3   1   0   1  21  0.73 1.11
+   42 K   -1 -1  0 -2  0  2  0 -3 -3 -4 -4  4 -3 -5 -1  2  3 -5 -4 -4    3   1   5   1   2   9   5   0   0   0   0  27   0   0   2  19  22   0   0   0  0.58 1.11
+   43 P    1 -3 -4 -1 -2  1 -2 -1 -4 -4 -3  0 -4 -1  7 -1 -2 -5 -4 -1   11   0   0   3   1   6   2   5   0   0   2   6   0   3  52   3   1   0   0   6  1.09 1.14
+   44 Q    1 -1  1  2 -2  3  5 -2 -3 -2 -5 -1 -4 -5 -3 -1 -1 -5 -4 -3   11   2   6  10   1  11  41   2   0   3   0   3   0   0   1   4   4   0   0   1  0.65 1.14
+   45 E   -3 -3  0  1 -6  0  7 -2 -2 -5 -5 -2 -4 -5 -3 -1 -3 -5 -4 -5    0   0   3   5   0   2  85   2   0   0   0   0   0   0   0   2   0   0   0   0  1.59 1.15
+   46 I    1 -4 -5 -5 -3 -2 -4  0 -5  5  0 -2  3 -3 -4 -3 -1 -5 -4  3   12   0   0   0   0   2   0   7   0  33   7   2   8   0   0   0   2   0   0  25  0.66 1.15
+   47 D    2  2 -1  2 -4  3 -1 -1 -3 -2 -4  2 -3 -2 -2  1  2 -5 -4 -3   17  10   2  11   0  15   1   5   0   3   0  13   0   2   2   8  11   0   0   1  0.34 1.15
+   48 G    2 -2  2 -2 -4 -1  0  2  1 -1 -2  1  1 -2 -4 -2  2 -5 -4  0   18   1  12   1   0   1   6  13   4   4   4   8   4   1   0   0  12   0   0   8  0.25 1.15
+   49 I   -1 -5 -5 -5  1 -5 -5 -3 -5  6  3 -5 -1  1 -5 -4 -3 -4 -3  0    4   0   0   0   3   0   0   2   0  49  31   0   0   7   0   0   0   0   0   3  0.98 1.15
+   50 K    2 -2 -3 -4 -3 -2 -4 -2 -4  2  1 -2  4 -3 -4  0  1 -5 -4  3   18   2   1   0   0   1   0   3   0  13  10   1  10   0   0   7  10   0   0  23  0.44 1.15
+   51 K    2  1  3  0 -4  0  0  2 -3 -4 -4  3 -4 -4 -3  1 -2 -4 -1 -4   19   8  14   5   0   4   5  13   0   0   1  18   0   0   0   8   1   0   2   0  0.41 1.10
+   52 D    2 -3 -2  3  4 -2 -1  2 -4 -1  0  0 -3 -4 -1 -1 -3 -4  0 -1   16   0   1  18  10   2   4  15   0   5  10   6   0   0   4   3   0   0   4   4  0.30 1.12
+   53 F   -2 -2 -2  1 -4 -2 -3 -2 -3 -1  0 -4  0  7 -4 -4 -3 -2  0 -2    3   2   2   8   0   2   1   3   0   2   9   0   2  61   0   1   0   0   1   2  1.12 1.07
+   54 E   -1  2  2  4 -4  1  1  0 -2 -5 -4  3 -4 -4 -3  1 -2 -4 -1 -4    5  11   9  22   0   5   7   6   0   0   1  19   0   0   0   9   2   0   3   1  0.48 1.06
+   55 E   -2  0  4  4 -5  0  4 -3  2 -5 -5  0 -4 -5 -3  0 -2 -5 -4 -4    2   5  21  22   0   4  25   0   4   0   1   6   0   0   0   7   1   0   0   0  0.71 1.06
+   56 P    0 -2  0 -2 -4  0 -2 -3  0  0 -1  2 -3  0  5  1 -2 -4 -3 -2    7   2   4   2   0   4   2   1   2   5   6  12   0   5  33  10   1   0   0   3  0.54 1.00
+   57 G    0 -2  0  1 -4 -3 -1  4 -3 -3  0 -1 -3 -1 -1  1  2 -4 -4 -3    7   2   4  10   0   0   3  29   0   0  10   4   0   3   3   9  15   0   0   1  0.36 1.04
+   58 F   -1 -2  0 -3 -4  0 -1  1  2 -3 -1  0 -3  4 -2  2  1 -1 -1 -1    5   2   4   1   0   5   3  12   5   1   5   6   0  20   2  15  10   1   1   4  0.26 1.09
+   59 L    1 -4 -4 -5 -3 -4 -4 -4 -4  0  4 -4  1  1 -4 -3  1 -4 -3  3   13   0   0   0   0   0   0   0   0   2  40   0   3   6   0   0   9   0   0  24  0.61 1.06
+   60 A    2  2 -3 -4 -1  3 -2 -3 -3 -1 -1 -2  1  3  1  0  0 -4 -1 -3   22  13   0   0   1  16   0   1   0   3   7   0   4  12   7   5   7   0   1   0  0.36 1.06
+   61 P    2  1 -3 -3 -4  1 -2 -1 -3 -2 -4  0 -3 -4  4  2  0 -5 -4 -1   17   7   0   0   0   8   2   5   0   2   1   5   0   0  24  17   7   0   0   4  0.52 1.07
+   62 T   -1 -2  3  1 -4 -1  2  0 -1 -4 -4  0 -1 -4 -3  1  4 -4 -4 -3    2   1  14   6   0   2  12   8   1   0   1   6   1   0   0  12  32   0   0   1  0.52 1.04
+   63 G   -2 -4 -3 -2 -5 -4 -4  7 -4 -6 -6 -4 -5 -5 -4  0 -4 -5 -5 -5    0   0   0   2   0   0   0  90   0   0   0   0   0   0   0   6   0   0   0   0  1.82 1.11
+   64 L   -1 -5 -6 -6 -4 -5 -5 -6 -5  3  4 -5  3  1 -5 -4 -3 -4 -3  3    4   0   0   0   0   0   0   0   0  17  49   0   6   5   0   0   0   0   0  19  0.91 1.14
+   65 F   -3  1 -2 -1 -1 -3 -3 -5  4 -2 -3 -1 -1  2 -4  0  3  1  5 -1    0   8   1   4   1   0   1   0  11   2   1   2   2   8   0   6  22   2  24   4  0.62 1.14
+   66 L   -2 -5 -6 -6 -4 -5 -5 -6 -5  4  4 -5 -1  2 -5 -5 -3 -4 -3  3    4   0   0   0   0   0   0   0   0  26  44   0   0   9   0   0   0   0   0  17  0.94 1.14
+   67 G    3  0  1  0 -1  0  0  4 -1 -5 -5  0 -1 -5 -4 -1 -3 -5 -1 -4   27   4   7   4   1   3   7  32   2   0   0   7   2   0   0   3   0   0   2   0  0.57 1.14
+   68 G   -2 -4  0 -1 -2 -2 -1  6 -4 -2 -6 -2 -5 -5 -3 -2 -4 -5 -5 -5    2   0   4   4   1   2   4  76   0   3   0   2   0   0   1   2   0   0   0   0  1.38 1.14
+   69 E   -1  0  0 -2 -4  3  1 -4 -1  0 -3  3 -1 -3 -4 -2  2 -5 -4  2    4   3   3   1   0  17   8   1   1   6   1  19   1   1   0   0  17   0   0  16  0.41 1.11
+   70 K   -3  3  0  0 -5 -1 -2 -2  2 -5 -3  6 -4 -5 -2 -1 -3 -5 -4 -5    0  13   3   4   0   0   0   3   6   0   2  63   0   0   2   3   0   0   0   0  1.08 1.11
+   71 Y   -3 -4 -1 -5  6 -4 -4 -5 -1 -3 -3 -4 -3  3 -5 -3 -3 -1  8 -3    0   0   3   0  21   0   0   0   0   0   1   0   0  13   0   0   0   0  58   0  1.65 1.07
+   72 M   -3 -2 -3 -4  1  0 -1 -4 -3  2  0  0  6  1 -4  1 -1 -4  0  1    0   1   0   0   3   4   5   0   0  13   8   7  22   6   0  12   4   0   3  11  0.42 1.07
+   73 V   -1 -4 -4 -5  4 -4 -4 -1 -4  1  0 -2  1  1 -4 -3  1 -4  0  5    4   0   0   0  10   0   0   6   0   6   9   2   3   5   0   0  10   0   4  41  0.59 1.11
+   74 I   -2 -5 -5 -5  1 -2 -5 -5 -5  5  3 -4 -1 -1 -1 -4 -1 -4 -3  2    3   0   0   0   3   3   0   0   0  42  25   0   0   1   4   0   3   0   0  14  0.81 1.11
+   75 Q   -3  6  0 -1 -5  4 -2 -3 -2 -5 -4  2 -3 -4 -4  1 -3 -4  0 -3    0  45   5   3   0  18   0   1   0   0   0   9   0   0   0  11   0   0   4   2  0.91 1.11
+   76 G    3 -4 -3  0 -4 -1  0  4 -1 -3 -4 -3 -4 -4 -1 -1 -2 -5  0 -1   31   0   0   7   0   2   7  34   1   1   0   0   0   0   3   4   1   0   3   4  0.62 1.11
+   77 E   -3 -2  0  6 -6 -2  5 -2 -3 -3 -5 -2 -5 -6 -4 -1  0 -6 -5 -5    0   2   2  45   0   0  36   2   0   2   0   0   0   0   0   4   6   0   0   0  1.15 1.14
+   78 Q   -2 -3  0  4  2  0  3 -2 -3 -4 -4  0 -4  0  3 -2 -2  2 -4 -4    3   0   5  27   5   3  22   3   0   0   1   6   0   4  16   1   1   3   0   0  0.64 1.06
+   79 G   -1  2  0  1 -2 -2 -2  4 -3 -3 -4 -2 -4 -4  0  1  1 -4 -1 -2    3  11   4   9   1   2   2  33   0   1   1   2   0   0   4  11  11   0   3   3  0.44 1.00
+   80 A    1  0 -1 -3 -4  0  0 -4  1 -2 -2  1  5 -1 -4  2  1 -5 -3  2   14   6   3   1   0   3   5   0   4   0   1   9  16   2   0  14   8   0   0  15  0.33 1.07
+   81 V    0 -3  0  2  1 -3 -3 -3 -1  1  1 -3  1 -3 -3  0 -2  0 -1  3    8   1   4  14   3   0   1   1   1   6  16   1   3   0   1   9   1   2   2  28  0.34 0.97
+   82 I   -3 -4 -4 -1 -3 -4 -4 -5 -5  6  2 -4  0  0 -4 -2  0  1 -3  1    0   0   0   5   0   0   0   0   0  53  19   0   2   4   0   3   6   2   0   6  0.84 1.03
+   83 R    0  5 -3 -4  0 -1 -3 -4 -2 -3 -2 -2  1  3 -3 -2 -1 -2  5 -3    7  36   0   0   2   2   0   0   0   0   2   0   4  10   1   3   3   0  26   0  0.82 1.03
+   84 G    2  0 -3 -2  1 -3 -4  5 -4 -4 -2  0 -4  0 -4  0  2 -5 -4 -4   15   4   0   2   3   0   0  40   0   0   5   5   0   4   0   5  14   0   0   0  0.59 1.09
+   85 K    0  2 -1 -3 -5  0 -1 -4 -3 -5 -5  6 -4 -5 -4 -2  0 -5 -4 -2    7  10   3   0   0   2   2   0   0   0   0  67   0   0   0   0   4   0   0   2  1.10 1.09
+   86 K   -2  1  1 -3 -1  1 -2 -2  1 -5 -2  6 -3 -5 -4  0 -3 -5 -4 -4    3   5   8   0   2   6   0   3   3   0   6  59   0   0   0   8   0   0   0   0  0.89 1.09
+   87 G    0 -1  0  2 -5  0  1  5 -2 -6 -5 -3 -5 -5  0 -2 -2 -5 -1 -5    6   4   4  10   0   5  11  49   1   0   0   0   0   0   5   2   2   0   2   0  0.79 1.09
+   88 P    2  0  1  0 -4  1  1  1  0 -4 -2  2 -3 -5  1  1 -2 -5 -4  0   15   4   8   5   0   7   7   9   2   0   3  14   0   0   6  10   1   0   0   8  0.24 1.09
+   89 G    0 -1 -3 -1  0  0  2  5 -4 -4 -2 -2 -4 -5 -4  1  1 -5 -5 -2    5   4   0   3   2   4  13  40   0   0   4   2   0   0   0  12   9   0   0   3  0.56 1.09
+   90 G    0 -4  2 -3 -5 -4 -4  7 -4 -6 -6 -4 -5 -5 -4  0 -3 -5 -5 -5    6   0  10   0   0   0   0  78   0   0   0   0   0   0   0   5   0   0   0   0  1.57 1.09
+   91 V   -1 -5 -5 -6  4 -5 -5 -2 -5  4  1 -5  1  2 -5 -4 -3 -4 -3  5    4   0   0   0   8   0   0   4   0  20  11   0   3   7   0   0   0   0   0  43  0.81 1.09
+   92 T    0 -4 -4 -4  5 -4 -4 -4  2  1 -1 -4 -2  2 -4  1  4 -4 -3  2    7   0   0   0  15   0   0   0   6   8   4   0   0   8   0   8  26   0   0  18  0.61 1.09
+   93 I    0 -5 -5 -5  3 -5 -5 -5 -5  5  2 -5 -1 -3 -1 -4 -2 -5 -4  3    7   0   0   0   6   0   0   0   0  40  19   0   0   0   4   0   2   0   0  23  0.84 1.09
+   94 K    0 -2 -3 -4  0  0 -2  2 -4  0 -2  2  1 -3 -4 -1  0 -4  1  4    7   2   0   0   2   5   1  14   0   4   2  14   3   0   0   5   4   0   6  31  0.35 1.09
+   95 K   -2  3 -2 -1 -5  1  0 -4  1 -2 -4  6 -1 -5 -2 -1 -1 -5 -4 -3    3  15   0   3   0   4   4   0   3   3   0  54   2   0   1   3   4   0   0   2  0.87 1.10
+   96 T    0 -3 -2 -3 -3 -3 -3 -1 -4 -1 -3  0 -1 -4 -3  1  6 -5 -4 -2    8   0   0   0   0   0   0   3   0   3   0   5   1   0   0   9  70   0   0   0  1.12 1.10
+   97 N    0  0  3 -2 -5 -1  0  2  1 -4 -4  3 -4 -5  1  0  0 -5 -4 -3    8   4  17   1   0   2   5  17   3   1   1  23   0   0   8   5   5   0   0   1  0.45 1.13
+   98 Q   -2  1 -1 -2 -5  6 -2 -2 -3 -4 -1  2  1 -4 -4  1  1 -4  1 -4    2   7   2   1   0  38   0   3   0   0   6  11   4   0   0  11  10   0   4   0  0.64 1.13
+   99 A    5 -4 -4 -4  2 -3 -4 -1 -4 -3 -2 -3 -3 -3 -3  1  2 -4  2  1   50   0   0   0   5   0   0   2   0   0   3   0   0   0   1   7  13   0   9   9  0.71 1.13
+  100 L   -2 -5 -6 -6 -2 -5 -5 -6 -5  4  4 -5  1  1 -5 -4 -3 -4  1  3    2   0   0   0   0   0   0   0   0  26  39   0   2   5   0   0   0   0   4  21  0.86 1.07
+  101 V   -3 -5 -6 -6 -3 -5 -5 -6 -5  5  3 -5  1 -2 -5 -4 -3 -5 -4  4    0   0   0   0   0   0   0   0   0  34  29   0   2   0   0   0   0   0   0  35  1.06 1.07
+  102 F   -3 -5 -6 -6 -4 -5 -5 -6 -5  6  1 -5  2  2 -5 -4 -3 -4 -3  4    0   0   0   0   0   0   0   0   0  47   7   0   4  10   0   0   0   0   0  32  1.10 1.07
+  103 G    3 -4 -3 -4 -1 -4 -4  5 -4 -3 -1 -4 -3 -4 -4  0 -3 -5 -4  2   29   0   0   0   1   0   0  40   0   0   7   0   0   0   0   7   0   0   0  16  0.78 1.07
+  104 F   -3 -4 -4 -5 -4 -1 -3 -5  5  3  0 -1  5 -1 -5 -3  1 -4  1  2    0   0   0   0   0   2   1   0  18  19   6   4  20   1   0   0  11   0   4  14  0.68 1.07
+  105 Y   -3 -4 -4 -5  1 -4 -4  3  3 -4 -4 -2 -4  2 -5 -4 -4 -1  8 -4    1   0   0   0   4   0   0  22   6   0   0   2   0   7   0   0   0   0  58   0  1.41 1.07
+  106 D   -2  0  2  4 -5 -1  1  1 -3 -5 -5  2 -2 -5  2 -1 -1 -5  0 -5    2   5   8  26   0   1  10  11   0   0   0  13   1   0  10   4   4   0   4   0  0.51 1.07
+  107 E    0  0  1  1 -5  0  5 -2 -3 -5 -3  1 -4 -5 -1 -1 -3 -5 -4 -3   10   5   7   7   0   1  52   2   0   0   2   6   0   0   3   3   0   0   0   2  0.78 1.04
+  108 P   -1 -4  0 -3 -4 -3 -2  4 -4 -5 -5 -1 -4 -5  6  1  0 -5 -2 -4    4   0   5   0   0   0   2  32   0   0   0   3   0   0  36  10   5   0   2   0  0.97 1.02
+  109 M    0 -4 -4 -4 -3  0 -2 -1  0  2  0 -3  5 -3 -4 -3  1 -4 -3  4    6   0   0   0   0   5   2   5   3  11   8   0  18   0   0   0   8   0   0  33  0.55 1.02
+  110 T   -2 -2  1 -3 -4  4  0 -4  5 -3 -1  0 -3 -3 -3  0  2 -4  2 -1    3   0   5   0   0  24   4   0  16   1   5   5   0   0   1   8  17   0   6   4  0.54 1.04
+  111 G    1 -1 -1 -3 -4  0 -1  3 -3 -4 -4 -3 -4 -5  6  0 -1 -5 -4 -4   11   3   3   0   0   5   4  22   0   0   1   0   0   0  39   5   4   0   0   0  0.89 1.00
+  112 G    0 -4 -2 -3 -4  0  0  6 -4 -5 -5 -3 -4 -5  0  0 -1 -4 -4 -4    7   0   0   0   0   4   6  65   0   0   1   0   0   0   5   8   3   0   0   0  1.09 1.00
+  113 Q   -1 -2  3  0  0  5  1 -2 -2  0 -2 -2  0 -4  0 -1 -1 -4 -4  0    4   1  18   3   2  30   9   3   0   5   2   0   3   0   4   4   3   0   0   7  0.47 1.00
+  114 C    3 -4  0 -4  8 -4 -4 -4 -4 -1  2 -4 -2 -4 -4 -1 -1 -4 -4  1   24   0   6   0  32   0   0   0   0   3  18   0   0   0   0   3   4   0   0   9  0.86 1.03
+  115 N    1  1  6 -2  0 -2 -3 -3 -2 -3 -2 -1 -3 -4 -2  0  0 -5  0  0   14   6  47   0   2   0   0   0   0   0   4   2   0   0   2   5   5   0   3   7  0.71 1.03
+  116 L   -1 -2  0 -2 -4  1  1 -4 -3 -3  1  4  4 -4 -4  0  0 -5 -4 -1    4   0   5   2   0   5   7   0   0   0  14  34  13   0   0   7   7   0   0   3  0.49 1.07
+  117 V    2 -3 -4 -2 -4 -1 -3 -1 -4  2 -2  2  0 -1  0 -2  2 -5 -4  3   20   0   0   2   0   3   0   4   0  10   1  16   2   3   4   0  12   0   0  24  0.37 1.07
+  118 V    2 -5 -5 -5  2 -4 -4 -5 -5  1 -1 -4  1 -3 -4 -3  1 -5 -4  5   16   0   0   0   4   0   0   0   0   4   4   0   3   0   0   0  11   0   0  58  0.89 1.07
+  119 E   -2 -3 -3 -2 -5  1  5 -1  2 -4 -2  1 -4  2 -4 -2 -3 -3  4 -4    3   0   0   0   0   4  47   5   5   0   4   8   0   9   0   1   0   0  14   0  0.77 1.07
+  120 R    0  4  1  0 -5  2  1  0 -3 -4 -5  4 -4 -5 -4  0 -2 -5 -2 -1    8  20   5   5   0   8   9   6   0   0   0  24   0   0   0   7   1   0   2   5  0.48 1.07
+  121 L   -4 -5 -5 -6  0 -4 -5 -6 -5  3  5 -5  5 -2 -4 -4 -2 -4 -3  1    0   0   0   0   2   0   0   0   0  14  62   0  14   0   1   0   2   0   0   6  1.07 1.06
+  122 G    5 -3 -4 -4 -3 -2 -4  4 -4  0 -3 -2 -3 -4 -4 -2 -3 -5 -4  0   49   0   0   0   0   2   0  31   0   6   2   2   0   0   0   0   0   0   0   8  0.83 1.05
+  123 D   -2 -1 -2  6 -5 -1  3 -1 -1 -5 -4  2 -5 -6 -4 -1 -2 -6 -5 -5    1   3   0  53   0   1  16   5   1   0   1  13   0   0   0   4   2   0   0   0  1.03 1.05
+  124 Y   -4 -2 -4 -5 -5 -1 -4 -2  3 -4 -4 -4 -3  1 -5 -1 -2  2  9 -4    0   2   0   0   0   2   0   4   6   0   0   0   0   2   0   4   1   2  76   0  1.74 1.05
+  125 L   -4 -5 -6 -6 -4 -4 -5 -6 -5  1  6 -5  1  0 -5 -5 -3 -4 -3  0    0   0   0   0   0   0   0   0   0   5  88   0   3   2   0   0   0   0   0   2  1.36 1.04
+  126 I   -1  4 -1 -4 -3 -2  0 -5 -4  3  0  2  0 -3 -4 -3 -1 -5 -3  1    5  30   3   0   1   0   5   0   0  23   6  11   2   0   0   0   3   0   0  12  0.53 1.01
+  127 E   -2  1  1  3  0  1  4 -2 -3 -5 -5  1 -1 -5 -3  3 -1 -5 -4 -4    0   6   6  14   2   4  29   3   0   0   0   8   1   0   0  25   2   0   0   0  0.62 0.98
+  128 S    2 -1  1 -3  1  5 -2 -3 -3 -2 -1  1 -1 -4 -3  2 -2 -5 -4  0   19   3   6   0   3  28   0   0   0   2   6   7   1   0   0  19   1   0   0   6  0.47 0.97
+  129 E   -2 -4  1 -1 -5  0 -3  7 -4 -2 -5 -3 -4 -5 -4 -2 -3 -5 -5 -5    0   0   6   3   0   6   1  81   0   4   0   0   0   0   0   0   0   0   0   0  1.48 0.94
+  130 L   -2 -3 -4 -5 -2 -3 -4 -4 -3  1  4 -3  6 -1 -4 -3 -2 -3 -2  1    0   0   0   0   0   0   0   0   0   0  60   0  31   0   0   0   0   0   0   9  0.76 0.36
+
+                      K         Lambda
+Standard Ungapped    0.1395     0.3170
+Standard Gapped      0.0410     0.2670
+PSI Ungapped         0.1795     0.3172
+PSI Gapped           0.0549     0.2670
diff --git a/sample/d8abp__.out b/sample/d8abp__.out
new file mode 100644 (file)
index 0000000..033d33b
--- /dev/null
@@ -0,0 +1,334 @@
+>prediction for: sample/d8abp__.prof
+
+#                  *         *         *         *         *         *
+AA:       NLKLGFLVKQPEEPWFQTEWKFADKAGKDLGFEVIKIAVPDGEKTLNAIDSLAASGAKGF
+SS:       CEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHCCCEE
+CN:       BBEEEEEEEEEEEEEEEEEEEEEEEEEEBBBEEEEEEEBBBBBEEBBEEEBEEBBEEEEE
+#                  *         *         *         *         *         *
+AA:       VICTPDPKLGSAIVAKARGYDMKVIAVDDQFVNAKGKPMDTVPLVMLAATKIGERQGQEL
+SS:       EEECCCCCCCHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCEEEECCCCHHHHHHHHHHH
+CN:       EEEEEEEBBEBBEEBEEEBBEEEEEEEEEEBBBBBBBEBEEEEEEEEEEEEEEEEEEEEE
+#                  *         *         *         *         *         *
+AA:       YKEMQKRGWDVKESAVMAITANELDTARRRTTGSMDALKAAGFPEKQIYQVPTKSNDIPG
+SS:       HHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHH
+CN:       EEEEEBBBBBBBEEEEEEEEEEEBEEEEEEEBEEEEEEEBBBBBBEEEEEBEBEBEEBBB
+#                  *         *         *         *         *         *
+AA:       AFDAANSMLVQHPEVKHWLIVGMNDSTVLGGVRATEGQGFKAADIIGIGINGVDAVSELS
+SS:       HHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCCCEEEEEECCCCCHHHHH
+CN:       EEEEEEEEEBBEBBBEEEEEEEEEEEEEEEEEEEEEBEBBBBBEEEEEEEEEBEEEBEEE
+#                  *         *         *         *         *         *
+AA:       KAQATGFYGSLLPSPDVHGYKSSEMLYNWVAKDVEPPKFTEVTDVVLITRDNFKEELEKK
+SS:       HHCCCCEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCEEEECCCHHHHHHHC
+CN:       BEBBBBEEEEEEEEEEBEEEEEEEEEEBEEBBBBBEBBBBEBBBEBEEEEEEEBBEBBBB
+#              
+AA:       GLGGK
+SS:       CCCCC
+CN:       BBBBB
+//
+
+>#   AA : SS P_H P_E P_C : CN     : RWCO
+    1 N : C   10  36  54 : B   13 : 1832
+    2 L : E   10  62  28 : B   27 : 3801
+    3 K : E    7  85   9 : E   28 : 3452
+    4 L : E    5  88   6 : E   42 : 5284
+    5 G : E    4  90   6 : E   41 : 4672
+    6 F : E    5  90   6 : E   41 : 4510
+    7 L : E    6  87   7 : E   39 : 4056
+    8 V : E    9  70  21 : E   34 : 3436
+    9 K : C   10  27  63 : E   26 : 2608
+   10 Q : C    7  10  84 : E   24 : 2264
+   11 P : C    6   7  87 : E   26 : 2312
+   12 E : C    8   6  85 : E   19 : 1809
+   13 E : C   13   7  81 : E   22 : 1909
+   14 P : C   32  10  59 : E   22 : 1933
+   15 W : H   71   9  19 : E   30 : 2442
+   16 F : H   86   6   7 : E   30 : 2125
+   17 Q : H   89   5   5 : E   23 : 1489
+   18 T : H   90   5   5 : E   24 : 1791
+   19 E : H   90   5   5 : E   35 : 2454
+   20 W : H   90   4   5 : E   28 : 1887
+   21 K : H   91   4   5 : E   21 : 1462
+   22 F : H   90   4   5 : E   29 : 2062
+   23 A : H   90   4   5 : E   39 : 2713
+   24 D : H   91   4   5 : E   25 : 1591
+   25 K : H   91   4   5 : E   19 : 1178
+   26 A : H   90   5   5 : E   30 : 2039
+   27 G : H   88   6   6 : E   33 : 1803
+   28 K : H   84   7   9 : E   19 :  858
+   29 D : H   67  10  24 : B   14 :  775
+   30 L : C   23  10  67 : B   24 : 1419
+   31 G : C    9   9  82 : B   19 : 1117
+   32 F : C   10  26  64 : E   34 : 2255
+   33 E : E    9  70  21 : E   26 : 1689
+   34 V : E    6  87   7 : E   41 : 2560
+   35 I : E    5  89   5 : E   38 : 2334
+   36 K : E    6  88   6 : E   34 : 2096
+   37 I : E    8  73  19 : E   30 : 1592
+   38 A : C   10  29  62 : E   26 : 1333
+   39 V : C    8  10  82 : B   15 :  465
+   40 P : C   11   8  81 : B   13 :  429
+   41 D : C   30  10  60 : B   17 :  514
+   42 G : H   72   9  19 : B   19 :  766
+   43 E : H   87   6   7 : B   14 :  357
+   44 K : H   89   6   6 : E   20 :  716
+   45 T : H   90   5   5 : E   30 : 1328
+   46 L : H   90   4   5 : B   26 : 1063
+   47 N : H   90   4   5 : B   17 :  299
+   48 A : H   90   5   5 : E   31 : 1156
+   49 I : H   90   5   5 : E   37 : 1738
+   50 D : H   91   5   5 : E   23 :  804
+   51 S : H   90   5   5 : B   20 :  517
+   52 L : H   89   5   6 : E   35 : 1758
+   53 A : H   88   6   7 : E   29 : 1651
+   54 A : H   81   7  12 : B   19 :  856
+   55 S : H   53   9  38 : B   20 : 1018
+   56 G : C   19   9  73 : E   24 : 1648
+   57 A : C    9   9  81 : E   38 : 2685
+   58 K : C   11  25  64 : E   33 : 2671
+   59 G : E    9  69  22 : E   46 : 3491
+   60 F : E    6  87   7 : E   52 : 3819
+   61 V : E    5  90   5 : E   52 : 3909
+   62 I : E    6  88   6 : E   49 : 3476
+   63 C : E    9  72  19 : E   44 : 3036
+   64 T : C   10  29  61 : E   37 : 2569
+   65 P : C    7  10  83 : E   30 : 1857
+   66 D : C    6   7  86 : E   24 : 1293
+   67 P : C    7   6  86 : E   23 : 1209
+   68 K : C    9   7  84 : B   14 :  609
+   69 L : C   12   8  80 : B   22 : 1131
+   70 G : C   31  10  59 : E   26 : 1035
+   71 S : H   71   9  20 : B   18 :  551
+   72 A : H   86   7   7 : B   17 :  489
+   73 I : H   88   6   6 : E   31 : 1155
+   74 V : H   89   6   6 : E   33 : 1170
+   75 A : H   90   5   5 : B   19 :  366
+   76 K : H   89   5   6 : E   22 :  636
+   77 A : H   87   6   7 : E   33 : 1385
+   78 R : H   83   7   9 : E   24 :  810
+   79 G : H   65  10  25 : B   16 :  465
+   80 Y : C   24  10  66 : B   23 :  934
+   81 D : C   10  10  81 : E   20 : 1070
+   82 M : C   10  25  65 : E   34 : 1955
+   83 K : E    9  69  22 : E   34 : 2237
+   84 V : E    6  88   7 : E   40 : 2507
+   85 I : E    5  90   5 : E   44 : 2996
+   86 A : E    5  90   5 : E   42 : 2516
+   87 V : E    6  84   9 : E   43 : 2686
+   88 D : E   10  59  31 : E   36 : 2108
+   89 D : C    9  23  68 : E   31 : 1721
+   90 Q : C    7  11  81 : E   24 : 1215
+   91 F : C    7   9  84 : B   27 : 1250
+   92 V : C    7   7  86 : B   21 :  639
+   93 N : C    7   7  86 : B   16 :  398
+   94 A : C    7   7  86 : B   17 :  403
+   95 K : C    7   7  86 : B   15 :  227
+   96 G : C    7   8  85 : B   20 :  499
+   97 K : C    7   9  84 : B   18 :  349
+   98 P : C    7   9  85 : E   23 :  696
+   99 M : C    6   8  86 : B   25 :  820
+  100 D : C    6  11  82 : E   24 :  810
+  101 T : C    9  31  60 : E   28 : 1009
+  102 V : E    8  72  20 : E   36 : 1242
+  103 P : E    6  87   7 : E   33 : 1274
+  104 L : E    6  87   7 : E   36 : 1397
+  105 V : E    8  73  19 : E   37 : 1450
+  106 M : C    9  35  56 : E   33 : 1172
+  107 L : C    9  14  77 : E   31 : 1192
+  108 A : C   14  10  76 : E   26 : 1039
+  109 A : C   40  11  49 : E   28 : 1181
+  110 T : H   77   8  14 : E   25 :  947
+  111 K : H   88   6   6 : E   24 : 1033
+  112 I : H   89   6   5 : E   32 : 1440
+  113 G : H   90   5   5 : E   33 : 1329
+  114 E : H   90   4   5 : E   28 : 1156
+  115 R : H   90   5   5 : E   26 : 1073
+  116 Q : H   90   5   5 : E   38 : 1819
+  117 G : H   90   5   5 : E   39 : 1545
+  118 Q : H   90   5   5 : E   27 : 1109
+  119 E : H   90   5   5 : E   29 : 1278
+  120 L : H   90   5   5 : E   42 : 1897
+  121 Y : H   90   5   5 : E   34 : 1337
+  122 K : H   90   4   5 : E   22 :  728
+  123 E : H   89   5   6 : E   26 : 1131
+  124 M : H   84   7   8 : E   33 : 1450
+  125 Q : H   68  11  21 : E   21 :  635
+  126 K : C   33  10  57 : B   14 :  336
+  127 R : C   11   7  82 : B   15 :  414
+  128 G : C    6   6  88 : B   18 :  521
+  129 W : C    6   7  88 : B   17 :  415
+  130 D : C    6   7  87 : B   15 :  445
+  131 V : C    5   7  88 : B   21 :  747
+  132 K : C    6  10  85 : B   18 :  544
+  133 E : C    9  27  65 : E   23 :  847
+  134 S : E    9  68  23 : E   29 : 1186
+  135 A : E    5  87   7 : E   33 : 1434
+  136 V : E    4  91   5 : E   42 : 1662
+  137 M : E    4  92   4 : E   42 : 1630
+  138 A : E    5  90   6 : E   39 : 1557
+  139 I : E    8  74  18 : E   37 : 1473
+  140 T : C    9  30  61 : E   30 : 1078
+  141 A : C    7  10  83 : E   27 :  987
+  142 N : C    7   7  86 : E   22 :  651
+  143 E : C    8   6  85 : E   19 :  510
+  144 L : C   12   7  81 : B   22 :  721
+  145 D : C   29   9  62 : E   20 :  673
+  146 T : H   67  10  23 : E   23 :  789
+  147 A : H   85   7   8 : E   28 : 1071
+  148 R : H   90   5   5 : E   23 :  663
+  149 R : H   90   5   5 : E   26 :  819
+  150 R : H   90   5   5 : E   33 : 1182
+  151 T : H   90   4   5 : E   28 :  790
+  152 T : H   90   5   6 : B   21 :  377
+  153 G : H   89   5   6 : E   27 :  685
+  154 S : H   88   6   6 : E   37 : 1335
+  155 M : H   89   5   5 : E   27 :  846
+  156 D : H   90   5   5 : E   21 :  606
+  157 A : H   88   5   6 : E   30 : 1177
+  158 L : H   86   7   8 : E   33 : 1267
+  159 K : H   82   8  11 : E   19 :  466
+  160 A : H   63  10  27 : B   16 :  438
+  161 A : C   24   9  67 : B   19 :  552
+  162 G : C    9   7  84 : B   13 :  292
+  163 F : C    7   6  87 : B   17 :  388
+  164 P : C    6   6  88 : B   13 :  433
+  165 E : C    6   8  85 : B   14 :  511
+  166 K : C    9  20  72 : E   21 :  924
+  167 Q : E    9  60  31 : E   21 :  798
+  168 I : E    6  84  10 : E   30 : 1426
+  169 Y : E    5  89   6 : E   29 : 1315
+  170 Q : E    6  88   7 : E   25 :  869
+  171 V : E    8  75  17 : B   26 : 1021
+  172 P : C   10  36  54 : E   24 :  878
+  173 T : C    7  13  80 : B   21 :  719
+  174 K : C    7   8  85 : E   19 :  481
+  175 S : C    8   8  84 : B   16 :  441
+  176 N : C   11   8  80 : E   22 :  776
+  177 D : C   27  11  62 : E   19 :  478
+  178 I : H   68  10  23 : B   21 :  611
+  179 P : H   86   6   8 : B   16 :  491
+  180 G : H   89   5   6 : B   20 :  709
+  181 A : H   90   5   5 : E   32 : 1447
+  182 F : H   91   5   5 : E   29 : 1240
+  183 D : H   91   5   5 : E   21 :  737
+  184 A : H   90   5   5 : E   33 : 1672
+  185 A : H   90   5   5 : E   40 : 1984
+  186 N : H   91   4   5 : E   27 : 1134
+  187 S : H   91   4   5 : E   23 :  921
+  188 M : H   89   5   5 : E   35 : 1768
+  189 L : H   87   6   7 : E   35 : 1811
+  190 V : H   81   8  11 : B   20 :  773
+  191 Q : H   58  10  32 : B   19 :  808
+  192 H : C   22   8  70 : E   24 : 1383
+  193 P : C   10   6  84 : B   17 :  969
+  194 E : C    8   6  86 : B   13 :  717
+  195 V : C    7   8  85 : B   26 : 1473
+  196 K : C    8  16  76 : E   21 : 1276
+  197 H : E   11  49  40 : E   32 : 2070
+  198 W : E    7  82  11 : E   34 : 2191
+  199 L : E    5  90   5 : E   47 : 2780
+  200 I : E    5  91   4 : E   48 : 2584
+  201 V : E    6  90   5 : E   47 : 2746
+  202 G : E   10  76  15 : E   50 : 2750
+  203 M : C   14  34  52 : E   44 : 2513
+  204 N : C   15  12  73 : E   38 : 2408
+  205 D : C   32  10  58 : E   38 : 2305
+  206 S : H   70   8  22 : E   32 : 1761
+  207 T : H   86   6   8 : E   38 : 1990
+  208 V : H   89   5   6 : E   42 : 2228
+  209 L : H   91   5   5 : E   36 : 1865
+  210 G : H   91   5   5 : E   37 : 1988
+  211 G : H   91   4   5 : E   46 : 2725
+  212 V : H   91   4   5 : E   41 : 2252
+  213 R : H   91   4   5 : E   29 : 1451
+  214 A : H   90   5   5 : E   37 : 1957
+  215 T : H   88   6   6 : E   40 : 2122
+  216 E : H   85   7   8 : E   23 :  844
+  217 G : H   71   9  20 : B   15 :  579
+  218 Q : C   33   9  58 : E   23 :  948
+  219 G : C   12   7  81 : B   13 :  383
+  220 F : C    8   7  85 : B   20 :  572
+  221 K : C    7   7  86 : B   12 :   95
+  222 A : C    6   7  87 : B   17 :  554
+  223 A : C    6   9  85 : B   13 :  569
+  224 D : C    9  24  67 : E   19 :  960
+  225 I : E    9  67  24 : E   31 : 1839
+  226 I : E    6  86   8 : E   35 : 2046
+  227 G : E    5  90   6 : E   40 : 2302
+  228 I : E    5  90   6 : E   46 : 2725
+  229 G : E    6  87   7 : E   43 : 2354
+  230 I : E    9  71  20 : E   41 : 2263
+  231 N : C   10  29  61 : E   34 : 1890
+  232 G : C    8  11  81 : E   32 : 1843
+  233 V : C    9   8  83 : B   28 : 1571
+  234 D : C   15   8  77 : E   21 : 1034
+  235 A : C   36  10  53 : E   27 : 1271
+  236 V : H   73   9  18 : E   30 : 1400
+  237 S : H   87   6   7 : B   19 :  761
+  238 E : H   89   6   6 : E   21 :  828
+  239 L : H   89   5   6 : E   32 : 1261
+  240 S : H   87   6   7 : E   23 :  783
+  241 K : H   83   7   9 : B   18 :  543
+  242 A : H   67  10  23 : E   26 : 1127
+  243 Q : C   31  10  58 : B   19 :  753
+  244 A : C   13   8  79 : B   18 :  655
+  245 T : C   10   9  81 : B   18 :  881
+  246 G : C   14  17  70 : B   22 : 1157
+  247 F : E   16  42  42 : E   31 : 1912
+  248 Y : E   11  74  16 : E   32 : 1847
+  249 G : E    7  86   7 : E   35 : 2098
+  250 S : E    7  88   6 : E   36 : 2291
+  251 L : E    8  85   7 : E   40 : 2636
+  252 L : E   15  67  19 : E   32 : 2040
+  253 P : C   20  32  48 : E   32 : 2141
+  254 S : C   30  16  54 : E   28 : 1700
+  255 P : H   66  10  23 : E   29 : 2046
+  256 D : H   86   6   8 : E   19 : 1282
+  257 V : H   89   5   6 : B   19 : 1132
+  258 H : H   89   5   6 : E   32 : 2165
+  259 G : H   91   4   5 : E   35 : 2440
+  260 Y : H   91   4   5 : E   27 : 1767
+  261 K : H   90   5   5 : E   29 : 1590
+  262 S : H   90   5   5 : E   44 : 2736
+  263 S : H   90   5   5 : E   42 : 2556
+  264 E : H   90   5   5 : E   29 : 1590
+  265 M : H   90   5   5 : E   33 : 1817
+  266 L : H   90   5   6 : E   43 : 2838
+  267 Y : H   90   5   6 : E   30 : 2050
+  268 N : H   89   5   6 : B   20 : 1239
+  269 W : H   86   6   8 : E   27 : 1660
+  270 V : H   80   8  11 : E   31 : 2063
+  271 A : H   60  11  29 : B   15 :  948
+  272 K : C   22   9  69 : B    9 :  327
+  273 D : C    9   6  85 : B   12 :  675
+  274 V : C    7   7  87 : B   13 :  638
+  275 E : C    6   8  86 : B   13 :  572
+  276 P : C    6   8  86 : E   22 : 1240
+  277 P : C    6   8  86 : B   15 :  841
+  278 K : C    6  10  84 : B   13 :  816
+  279 F : C   10  23  67 : B   18 : 1249
+  280 T : E   12  59  29 : B   21 : 1582
+  281 E : E   11  71  19 : E   19 : 1547
+  282 V : E   11  48  41 : B   23 : 1672
+  283 T : C    7  19  75 : B   21 : 1634
+  284 D : C    5  12  83 : B   18 : 1441
+  285 V : C    7  29  64 : E   30 : 2290
+  286 V : E    7  72  20 : B   25 : 1927
+  287 L : E    5  88   7 : E   36 : 2841
+  288 I : E    6  88   7 : E   33 : 2808
+  289 T : E    9  71  20 : E   27 : 2311
+  290 R : C   11  27  62 : E   25 : 2257
+  291 D : C   11  11  79 : E   19 : 1589
+  292 N : C   26  12  62 : E   23 : 1799
+  293 F : H   68  11  21 : E   30 : 2144
+  294 K : H   85   7   8 : B   16 : 1062
+  295 E : H   88   6   6 : B   14 :  707
+  296 E : H   88   6   6 : E   24 : 1584
+  297 L : H   86   6   7 : B   22 : 1625
+  298 E : H   82   8  10 : B   15 : 1124
+  299 K : H   65  10  25 : B   15 : 1080
+  300 K : C   27  10  63 : B   16 : 1555
+  301 G : C   10   7  82 : B   17 : 1788
+  302 L : C    8   7  85 : B   19 : 2107
+  303 G : C    8   8  84 : B   14 : 1490
+  304 G : C    7   8  85 : B   14 : 1440
+  305 K : C    6   7  87 : B   12 : 1332
diff --git a/sample/d8abp__.prof b/sample/d8abp__.prof
new file mode 100644 (file)
index 0000000..2ac96c5
--- /dev/null
@@ -0,0 +1,314 @@
+
+Last position-specific scoring matrix computed, weighted observed percentages rounded down, information per position, and relative weight of gapless real matches to pseudocounts
+           A  R  N  D  C  Q  E  G  H  I  L  K  M  F  P  S  T  W  Y  V   A   R   N   D   C   Q   E   G   H   I   L   K   M   F   P   S   T   W   Y   V
+    1 N   -4 -4  3  7 -6 -2  3 -4 -3 -6 -6 -3 -5 -6 -4  0 -3 -6 -5 -5    0   0  12  63   0   0  18   0   0   0   0   0   0   0   0   8   0   0   0   0  1.45 1.17
+    2 L   -4 -3 -4 -6 -2 -5 -4 -6 -5  3  4 -2  2 -2 -5 -5 -1 -5 -2  4    0   1   1   0   1   0   1   0   0  16  42   2   4   1   0   0   4   0   1  26  0.87 1.45
+    3 K   -3  3 -2 -4 -5  0 -2 -5 -1 -4 -5  6 -4 -3 -4 -2  2 -6 -2  1    1  16   1   0   0   4   1   0   1   0   0  47   0   1   0   1  14   0   1  12  0.94 1.59
+    4 L   -3 -6 -7 -7 -4 -6 -6 -7 -7  7  0 -6  0 -1 -6 -5 -4 -6 -4  3    1   0   0   0   0   0   0   0   0  72   7   0   2   2   0   0   0   0   0  16  1.67 1.79
+    5 G    3 -4 -4 -4 -3 -5 -4  6 -5 -6 -5 -5 -5 -6 -3 -2 -4 -6 -4 -3   22   0   0   1   1   0   0  69   0   0   1   0   0   0   1   1   1   0   0   2  1.54 1.81
+    6 F   -3 -6 -4 -6 -3 -5 -6 -5 -5  2  3 -6  3  4 -6 -4 -3 -4 -1  4    2   0   1   0   0   0   0   1   0   8  28   0   8  19   0   0   1   0   2  30  0.93 1.80
+    7 L    0 -5 -5 -4 -3 -5 -5 -5 -6  4  2 -5  0 -1 -5  2  1 -6 -4  3    7   0   0   1   0   0   0   0   0  23  18   0   2   2   0  16   8   0   0  23  0.67 1.82
+    8 V   -2 -4 -1 -6 -5  0 -5 -4 -3  3  0 -4  3 -2 -1 -2  0 -3  0  5    3   0   3   0   0   4   0   1   1  15   9   1   6   2   4   3   5   0   3  41  0.68 1.85
+    9 K    0 -2 -1 -1 -5  0 -2 -1  0 -3 -3  3 -2 -4  4  1  0 -6  0 -3    8   2   3   3   0   4   2   6   2   1   2  21   1   0  23  11   7   0   3   2  0.50 1.85
+   10 Q   -1 -4  2  4 -5  1  0  0 -1 -3 -3 -1 -1 -4 -5  1  3 -6 -1 -1    5   0  10  20   0   8   4   9   2   1   3   3   1   1   0  10  16   0   2   5  0.39 1.85
+   11 P    0 -3 -4 -2 -3 -2 -4 -3 -3  3  3 -3  0  1  1  1  0 -5 -1  1    6   1   0   3   0   1   0   2   0  14  27   1   2   5   7  12   6   0   2   8  0.34 1.85
+   12 E    1 -1  2  3 -3  0  2  0 -3 -3 -4 -3 -1 -3 -3  1  3 -6 -4 -2    9   3  10  14   0   5  11   8   0   2   1   1   1   1   1  12  18   0   0   2  0.39 1.85
+   13 E   -2 -4  6  3 -6 -2  2 -2  3 -2 -5 -4 -3 -6 -4  0 -2 -7 -4 -3    3   0  46  15   0   1  11   2   7   3   1   0   1   0   0   6   1   0   0   2  1.06 1.87
+   14 P   -1 -1 -1 -2 -6 -2 -1 -1 -3 -4 -4 -4 -5 -2  7 -2  0 -6 -3 -4    6   4   3   2   0   1   4   5   0   1   1   0   0   2  60   3   5   0   1   1  1.41 1.87
+   15 W   -4 -4 -5 -7 -6 -4 -6 -5 -4 -3 -3 -6 -2  7 -7 -5 -5  8  5 -4    1   1   0   0   0   1   0   1   0   1   0   0   1  55   0   0   0  21  18   1  2.10 1.87
+   16 F   -4 -1 -4 -5 -2 -3 -5 -5 -3 -1 -1 -4  0  7 -5 -2 -3  6  4 -3    1   4   1   0   1   1   1   0   0   2   3   1   3  55   0   3   1   9  11   1  1.45 1.87
+   17 Q    2 -2  0 -1 -5  3 -2 -1 -3 -1 -2  0 -1 -3  0  1  1 -6 -5  2   20   2   4   3   0  12   1   4   0   3   3   4   1   1   5  12   7   0   0  14  0.29 1.88
+   18 T    1 -1  0  2 -5  1  3 -3 -1 -2 -3  0 -3 -4 -1  1  1 -6 -2 -1   14   4   4  10   0   7  23   2   1   2   2   4   0   0   2   8  10   0   1   4  0.35 1.88
+   19 E   -2 -1 -3 -3 -1 -1  1 -2 -4  2  2 -3  5  0 -6 -4 -3 -3  0  3    3   3   1   1   1   2  11   3   0  13  17   1  16   4   0   1   1   0   3  17  0.48 1.88
+   20 W    2  1  0 -2 -3  1 -1 -1 -3  2  0  1 -2 -4 -5 -1  0  2 -2  1   17   7   4   2   0   6   5   4   0  11   7  10   1   1   0   3   5   3   2  12  0.19 1.87
+   21 K    0  3  2  1 -4  2  2 -2  0 -4 -3  3 -2 -6 -5 -1 -2 -6 -3 -2   10  16   8   9   0   8  13   2   2   1   2  17   1   0   0   3   2   0   1   3  0.45 1.89
+   22 F    2 -3 -2 -2 -5 -3 -3  5 -1 -2 -4 -4 -2  0 -4  0 -1 -5 -2 -2   18   1   1   2   0   1   1  50   2   3   1   1   1   5   1   6   3   0   1   3  0.85 1.88
+   23 A    4 -5 -5 -4  0 -3 -4 -3 -5  4 -1 -3  2 -1 -4 -3 -3 -6 -2  3   30   0   0   1   2   1   1   2   0  22   5   1   5   3   1   1   1   0   1  24  0.71 1.87
+   24 D   -2 -1 -2  1 -6  2  5 -2 -4 -3 -4  3 -2 -3 -4 -1 -1 -6 -5 -2    3   2   1   7   0   8  43   3   0   2   2  16   1   1   0   4   3   0   0   3  0.79 1.88
+   25 K    2  1  1  3 -5  2  2 -3  0 -4 -4  2 -3 -4 -5  0 -1 -3 -5 -4   20   6   6  15   0   9  13   1   2   1   2  14   0   1   0   6   3   0   0   1  0.47 1.89
+   26 A    4  0 -3 -3 -2  0  1 -3 -2 -1 -2  1  0 -1 -5 -1 -2  0  2  1   34   4   1   1   1   5  10   2   1   3   4   8   2   2   0   4   3   1   6   9  0.37 1.89
+   27 G    5 -4 -4 -3  4 -2 -3  1 -4 -1  0 -4 -2 -2 -5 -1 -2 -6 -5 -1   55   0   1   2   8   2   1   8   0   3   9   1   1   2   0   3   1   0   0   3  0.85 1.88
+   28 K   -1  2  1  0 -6  1  2 -3  1 -4 -3  5 -4 -3 -3 -1 -2 -6  1 -4    6  11   7   4   0   6  14   1   3   1   2  30   0   1   1   5   2   0   4   0  0.54 1.89
+   29 D    1  1 -2  2 -6  2  4 -3 -2 -3 -3  3 -3 -5 -2  0 -2 -4 -4 -4   13   7   1  11   0   8  24   2   1   2   3  18   0   0   2   5   2   0   0   1  0.52 1.88
+   30 L    0  1  1 -1 -3  0  0 -5  2 -1  2  1  0 -1 -3 -1 -1 -5  1 -1   10   8   6   3   0   5   5   0   6   2  24  10   2   3   1   4   3   0   4   3  0.23 1.88
+   31 G   -2 -3  2  0 -6 -1 -3  6 -2 -7 -6 -1 -6 -6 -5 -1 -3 -6 -4 -6    2   1   9   4   0   2   1  70   1   0   1   3   0   0   0   3   1   0   0   0  1.43 1.89
+   32 F    0 -3 -3 -4 -1 -4 -4 -3 -1  0  0 -2  0  3 -4 -3 -2  0  6  2    9   2   1   1   2   0   1   2   1   6   7   2   2  12   1   1   2   1  31  16  0.70 1.88
+   33 E   -1 -1  2  3 -1  2  2 -2 -1 -3 -3  1  0 -3 -4  1  3 -3 -2 -3    4   3   8  13   1   8  14   2   2   1   3   9   2   1   0   9  16   0   1   2  0.34 1.88
+   34 V   -2 -5 -5 -4 -1 -4 -5 -4 -4  2  3 -4  1  0 -3 -5 -1 -3 -1  5    3   0   0   1   1   0   0   1   0  10  31   1   3   4   1   0   3   0   2  36  0.80 1.88
+   35 I   -3 -3 -3 -4 -3 -3 -4 -6 -6  5  2 -3  1  1 -5 -3  0 -2 -2  4    1   1   2   1   0   1   1   0   0  29  15   2   3   5   0   2   5   1   1  30  0.77 1.88
+   36 K   -1 -2 -3 -3  2  1 -1 -2 -3  0  2 -1  1  1 -3  0  1 -1  2  1    6   2   1   1   4   8   4   3   1   4  23   4   3   6   1   8   8   1   6   8  0.20 1.84
+   37 I   -1 -3  4  2  3  0 -2 -3 -3  1 -1 -3 -1  0 -2  0  0 -5  1  1    5   1  21  11   6   4   2   2   0   9   5   1   2   4   2   7   5   0   4   9  0.33 1.86
+   38 A    4 -3  1  2 -2 -2 -3  2  0 -5 -5 -3 -1 -5 -3  2  1 -6 -4 -4   30   1   7  10   1   2   1  17   3   0   0   1   1   0   1  15   8   0   0   0  0.57 1.87
+   39 V    0 -1  2  2 -3  1  0  1 -1 -2 -4  0 -3 -4 -1  1  2 -3 -2  0    9   3  10  11   0   5   6  10   2   3   1   6   0   0   3  11  12   0   2   7  0.21 1.84
+   40 P   -1  0  2  3 -6  3  2  0  1 -5 -3 -1 -2 -2  2 -1 -2 -2 -2 -4    6   6   8  14   0  12  14   8   3   0   2   4   1   2  10   4   2   1   2   1  0.36 1.85
+   41 D   -3 -1  3  6 -6 -1 -1 -2 -1 -4 -5 -1 -5 -6 -3  1 -2 -7 -3 -5    1   3  13  53   0   2   3   3   1   1   1   3   0   0   1  11   1   0   1   0  1.15 1.84
+   42 G    2 -2 -1 -1 -5  1  1  0 -1 -1 -2 -1 -3 -3  3  0 -1 -3 -2  1   15   2   3   3   0   6  11   8   2   4   5   3   0   1  15   6   3   0   2  11  0.23 1.85
+   43 E    2 -1  2  2 -5  2  4 -2 -3 -4 -3 -1 -5 -6 -1  1  0 -6 -5 -2   15   3   8   9   0   8  24   3   0   0   2   4   0   0   3  12   5   0   0   3  0.44 1.85
+   44 K   -1  2  0  0 -6  2  1 -2 -1 -3 -2  5 -1 -5 -3 -1  1 -6 -4 -2    4  10   4   5   0   8   7   3   1   2   5  32   2   0   1   3   9   0   0   2  0.48 1.85
+   45 T   -2 -1 -3 -2 -3  7  3 -4 -1 -2 -3 -2  1 -4 -3 -2 -1 -5  0 -1    3   2   1   1   1  49  19   1   1   2   2   1   3   1   1   2   3   0   3   5  1.01 1.84
+   46 L    0  2  1 -1 -5  1 -1 -4 -3  3  2  0  0 -2 -5 -1 -2 -5 -3  1    7  10   8   4   0   5   3   1   1  14  19   5   3   2   0   5   2   0   1  10  0.25 1.81
+   47 N    2  2  2  1 -5  2  2 -2 -1 -5 -4  0 -2 -5 -4  2  1 -6 -5 -4   16  10  11   9   0  11  11   3   1   0   1   5   1   0   0  13   7   0   0   1  0.43 1.83
+   48 A    2 -3  0  1 -2  4 -2 -4  0  0  0 -3 -1 -1 -5 -1 -2 -1  4 -1   17   0   5   8   1  23   2   0   2   5   9   0   2   2   0   5   2   1  14   4  0.47 1.82
+   49 I   -1 -5 -6 -6 -2 -4 -4 -5 -4  5  3 -4  1  1 -6 -4 -3 -5 -1  3    4   0   0   0   1   1   1   1   0  37  22   1   3   5   0   1   1   0   2  21  0.93 1.82
+   50 D   -2  1  1  4 -6  2  5 -3 -2 -5 -5 -1 -4 -5 -3 -1 -2 -6 -2 -5    3   9   7  21   0  10  36   1   1   0   0   3   0   0   1   3   2   0   1   1  0.85 1.84
+   51 S   -1 -1  4  2 -5  2  0 -3 -1 -2 -1 -2  2 -2 -5  1  2 -6 -1 -2    6   3  21  11   0   8   6   2   1   2   5   2   5   2   0   8  13   0   2   3  0.37 1.84
+   52 L    1 -4 -6 -5 -1 -4 -5 -6 -5  0  4 -3  5  4 -6 -4 -3 -3 -2  0   11   1   0   0   1   0   0   0   0   3  46   1  14  15   0   1   1   0   1   4  0.92 1.84
+   53 A    0 -1 -4 -6 -2 -2 -3 -3 -1  5  2 -2  1 -2 -5 -3  0 -2 -3  1   10   4   1   0   1   2   1   2   1  33  20   3   4   1   0   2   5   1   1  10  0.56 1.83
+   54 A    3  0  2 -1 -5  2  1 -1  0 -2 -3 -1 -4 -3 -4  1  2 -6 -3 -1   25   4   8   4   0  10   8   4   2   2   2   4   0   1   0  11  11   0   1   4  0.35 1.81
+   55 S    0  3  0 -1 -6  5  0 -3  1 -5 -3  4 -2 -5 -5  0 -1 -6 -2 -4    7  16   5   2   0  26   4   1   3   0   3  21   1   0   0   6   3   0   1   0  0.69 1.83
+   56 G   -2  4  1 -1 -6  0 -2  4  1 -5 -5  3 -5 -5 -5 -2 -4 -2 -3 -5    2  20   7   3   0   5   1  36   3   1   1  18   0   0   0   1   1   1   1   0  0.83 1.84
+   57 A    1 -6 -4 -5  1 -4 -5 -6 -4  2 -2 -5 -2 -1  1 -3 -2 -1  1  6   13   0   1   0   3   1   0   0   0   8   1   0   0   3   7   2   2   1   5  53  0.94 1.85
+   58 K   -1 -2  1  7 -3  0  1 -3 -3 -4 -6  1 -5 -6 -5 -1 -3 -7 -6 -5    6   2   5  59   1   4   6   1   1   1   0  10   0   0   0   3   1   0   0   0  1.26 1.83
+   59 G    3 -5 -4 -4 -5 -5 -5  5 -5 -1 -1 -5 -2 -2 -5 -2 -3 -5 -2  0   27   0   0   1   0   0   0  48   0   3   6   0   1   2   0   1   1   0   1   8  0.99 1.84
+   60 F   -3 -6 -6 -6 -2 -5 -6 -5 -6  6  4 -6  1  1 -6 -5 -4 -1 -4  2    2   0   0   0   1   0   0   1   0  44  32   0   3   6   0   0   0   1   0  10  1.15 1.81
+   61 V    0 -6 -6 -6 -2 -5 -6 -3 -6  5  2 -5  1 -1 -5 -4 -3 -5 -4  4   10   0   0   0   1   0   0   2   0  34  19   0   2   2   0   1   1   0   0  29  0.95 1.82
+   62 I   -3 -6 -6 -6 -2 -3 -4 -6 -6  5  2 -5  1  1 -6 -4 -2 -5 -2  4    2   0   0   0   1   1   1   0   0  37  19   0   3   5   0   1   2   0   1  26  0.97 1.83
+   63 C    2 -4  3  0  5 -1 -3 -3 -1 -1 -2 -3  0 -1 -3  1  1 -3 -2  0   18   1  15   5  12   3   1   2   2   4   5   1   2   3   1  10   8   0   2   8  0.40 1.94
+   64 T    1 -4 -1 -2 -1 -2 -4 -3 -2 -2 -1 -4 -1 -5  6  1  1 -6 -3  1   13   1   3   2   1   1   0   1   1   2   8   0   1   0  37  11   7   0   1   9  0.76 1.92
+   65 P    2 -3  0 -2 -3 -1 -1 -1 -2  0 -1 -3 -1 -2  3  0  1 -5 -2  3   16   1   4   2   1   2   5   5   1   4   5   1   2   2  13   6   9   0   2  18  0.26 1.85
+   66 D   -3 -3  2  6 -5 -1  0  0 -1 -4 -2 -2 -4 -3 -3  1 -1 -5 -1 -3    2   1   9  45   0   2   6   7   2   1   4   2   0   1   1   8   4   0   3   2  0.82 1.82
+   67 P    0 -2 -1 -1 -3  0 -1  0  0 -1 -2 -2 -4 -3  3  3  1 -3 -1  0    8   2   3   3   1   4   5   7   2   3   4   2   0   1  16  21   9   0   2   8  0.30 1.86
+   68 K    0  0  0  3 -5  1  2 -2  0 -3 -3  2 -3 -3 -2  1  1 -5 -3 -2    9   5   4  16   0   5  14   4   2   2   2  13   0   1   2   8   8   0   1   2  0.31 1.85
+   69 L    4 -3 -1 -1 -2 -2 -1  1 -2 -1  1 -2 -2 -2  0  0  0 -5 -2  0   31   1   3   4   1   2   4  10   1   3  14   2   1   2   4   6   6   0   1   5  0.29 1.85
+   70 G    1 -4 -1 -1 -2 -2 -2  0  0  1  3 -3  0  0 -3  1  0  1 -2  0   10   1   2   4   1   2   3   7   2   7  25   1   3   3   1  11   7   2   1   7  0.21 1.84
+   71 S    0  0  0  1  0  0  0  0 -2  0 -2  1 -1 -4  3  0  1 -5 -3  0    8   5   4   7   2   4   7   6   1   5   3   9   1   1  14   8   7   0   1   8  0.17 1.83
+   72 A    2  0  1  1 -5  0  1  0 -1 -2 -3 -1 -2 -4  4  0  0 -5 -4 -2   15   5   7   7   0   4  11   6   2   2   3   3   1   1  20   6   5   0   1   3  0.34 1.85
+   73 I    1 -2 -3 -2 -2 -1 -3 -2 -1  3  1 -3  3 -1 -1 -1  0  0 -1  2   14   2   1   3   1   3   2   3   1  17  11   1   6   3   4   4   6   1   3  16  0.26 1.80
+   74 V    0 -4 -1 -3 -1 -3 -2 -4 -2  4  3 -4  2 -1 -3 -3  0 -5 -1  3    7   1   3   1   1   1   3   1   1  22  24   1   4   2   1   1   5   0   2  18  0.49 1.83
+   75 A    1  1  1  2 -3  3  3 -3 -1 -3 -2  3 -2 -3 -4  0 -2 -5 -4 -3   10   7   6  10   1  12  19   2   1   1   4  17   1   1   0   5   1   0   0   2  0.43 1.80
+   76 K    0  3 -1 -1 -5  2  2 -3 -1 -1 -1  4  0 -5 -2 -1 -1 -5 -2 -3    8  13   3   4   0   8  11   2   1   3   8  24   3   0   2   5   3   0   2   2  0.36 1.80
+   77 A    5 -3 -3 -2  0 -3 -3 -3 -2  0  1 -2  0 -2 -2 -2 -3 -5  0 -1   50   1   1   2   2   1   1   1   1   6  15   2   2   2   2   2   1   0   4   5  0.65 1.82
+   78 R    1  3  0 -2 -2  0  0 -3  0 -1 -1  3  1 -2 -2 -2  0  0 -1  0   10  15   4   2   1   4   6   2   2   4   6  18   4   1   2   3   5   1   3   6  0.23 1.77
+   79 G    2  1 -1  2 -2  2  2  0  0 -3 -4  1  0 -3 -2  1 -1 -1 -2 -3   15   6   3  13   1   9  11   6   2   1   2  10   2   1   2  11   3   1   1   2  0.27 1.77
+   80 Y    4  0  0 -1 -4  2 -1 -1  1 -3 -2  1 -1 -1 -3  0 -2  1  0 -2   30   4   5   3   0  11   4   4   3   2   3   9   2   3   1   6   2   2   3   3  0.32 1.74
+   81 D    0  0  2  2 -5 -1 -1  5  0 -5 -5  0 -5 -5 -2 -2 -2  0 -5 -5    6   5  10  11   0   3   3  44   2   0   1   6   0   0   2   2   2   1   0   0  0.76 1.75
+   82 M   -1 -2 -2 -5  0 -4 -2 -2 -5  5  1 -2  1 -1 -5 -2  0 -5 -1  2    6   3   3   0   2   0   3   3   0  32  12   3   3   2   0   4   7   0   2  15  0.47 1.63
+   83 K    0 -1 -1 -1 -5 -1 -1 -2 -4 -1 -2  1  0 -1  6 -2 -1  2  0 -2    7   3   3   3   0   3   3   3   0   3   4   8   3   3  39   3   3   3   3   3  0.68 1.67
+   84 V   -1 -4 -5 -5  1 -1 -4 -2 -5  2  0 -1  1  0 -5 -1  0  3  0  5    4   0   0   0   3   4   0   4   0   9   9   4   4   4   0   4   5   3   4  38  0.54 1.68
+   85 I   -1 -5 -3 -5 -4 -1 -5 -2 -5  4  0 -5  2  1 -5 -2  0 -5 -4  5    6   0   2   0   0   3   0   3   0  23   7   0   4   5   0   3   5   0   0  39  0.76 1.66
+   86 A    2 -3  0 -2  2 -2 -2 -3 -1  0  2 -4  0  1 -4  0  2 -4  0  1   17   1   4   2   5   2   2   2   2   4  17   0   2   6   0   6  14   0   3  10  0.25 1.61
+   87 V   -1 -4 -2 -3  2 -3 -4 -3  0  3  1 -4  2  2 -3 -3 -2  2  2  3    5   0   3   2   5   1   0   2   2  14  12   0   6   9   1   2   2   3   8  23  0.44 1.59
+   88 D   -2 -4  3  6 -5 -2  0 -1 -3 -1 -3 -2 -1 -4 -2 -1 -2  1 -2 -2    4   0  12  48   0   2   5   5   0   3   2   2   2   0   2   4   3   2   2   3  0.85 1.56
+   89 D   -1  5  2  1 -2 -1 -1 -2  0 -2 -3 -1 -1 -4 -2  1  0  3 -2 -1    5  28   9   7   1   3   3   3   2   3   3   4   2   1   2  10   6   4   1   5  0.39 1.64
+   90 Q   -1  2 -1  1 -2  2  2  0 -1 -2 -1  1  0 -3  2 -1 -1 -1 -2 -2    6  11   3   7   1   8  11   7   1   2   6   7   2   1  12   5   3   1   1   3  0.19 1.63
+   91 F    0 -2 -2 -2 -1 -2 -2 -2 -2  2  2 -2  0  2  3  0 -1 -1 -2  1    7   2   2   2   1   1   3   3   1  12  18   2   2   8  15   6   5   1   1   8  0.26 1.64
+   92 V    0 -1 -1  2  0 -1  0 -1 -1  1  0 -1 -1 -1 -1  1  0 -1  0  2    7   3   3  10   2   3   6   5   1   8   7   4   2   2   3   9   7   1   3  14  0.08 1.61
+   93 N   -1  0  3  3 -3 -1  1  0  0 -3 -2 -1 -2 -3  1  0 -1 -2 -1 -2    6   4  16  19   0   3   7   8   2   2   4   4   1   1   7   6   4   1   2   3  0.30 1.66
+   94 A    3 -1 -1  0 -1  0  0  1  0 -1 -1  0 -2 -1 -1  1 -1 -1 -2 -2   21   4   3   6   1   5   6  12   3   3   6   6   1   2   3  10   4   1   2   3  0.15 1.74
+   95 K    2  0  0  3 -1 -1  1  0 -1 -3 -2  1 -2 -2  0  0  1 -1 -3 -1   14   4   5  14   1   2   8   6   1   2   3  10   1   2   4   7   8   1   1   5  0.18 1.77
+   96 G    0  0  0  0 -1 -1 -2  3  0  0  0 -2  0 -3 -2  0  0 -1 -2  1    8   5   4   4   1   3   3  24   2   5   9   3   3   1   2   7   5   1   2   9  0.18 1.74
+   97 K    0 -1  2  3 -2  0  0 -2 -1 -2 -1  2 -2 -3 -1  0  0 -1 -3  0    7   3   9  15   1   4   5   4   1   2   6  13   1   1   4   8   5   1   1   7  0.19 1.79
+   98 P    1 -2 -1 -1 -2 -1 -1 -2 -3 -2 -2 -1 -1  0  4  2  0 -2  1 -1   11   2   2   4   1   2   5   3   0   2   4   4   1   5  23  13   6   1   4   4  0.33 1.75
+   99 M   -1 -2 -2  0 -1  0  0 -1  0  2  0 -1  1  0 -1 -1  0  0  4  1    5   2   2   5   1   5   6   6   2  11   8   4   3   3   3   5   5   1  13   8  0.13 1.68
+  100 D    0 -2  1  3  0  1  1 -1  0 -1 -2  0 -1 -2  1  0  1 -1 -2 -2    8   2   6  15   2   6  10   5   2   3   5   5   1   1   7   7   7   1   1   3  0.16 1.78
+  101 T    1  0  2  1  0  1 -1 -1  0 -2 -2  1  0 -1 -2  1  1  0  1 -1   10   6   9   9   2   5   4   5   2   2   3   8   3   2   2  10   8   1   4   5  0.12 1.81
+  102 V    2 -2 -1 -2  0 -2 -2 -3 -2  2  0 -3  0  0 -3 -1  0  1 -1  3   17   3   3   3   2   2   2   2   1  10   9   2   2   4   2   5   6   2   2  23  0.26 1.80
+  103 P    1 -1 -1  0  1 -2 -1 -2  0  0 -2 -2 -3  0  3  0  0  2  2  0   10   3   3   7   3   2   4   3   3   5   5   3   0   4  15   8   7   3   8   6  0.19 1.69
+  104 L   -2 -2 -1 -2  1  0 -3 -2  3 -1  0 -3 -1  4 -2  1 -1  0  5 -2    3   2   2   2   3   4   2   3   7   4   8   1   1  14   2  12   3   1  21   3  0.44 1.88
+  105 V   -1 -2  0 -2 -4 -4 -1 -2 -2  4  0 -3  0 -1 -2 -2 -2 -5 -2  4    4   2   6   2   0   0   4   3   1  19  10   1   2   3   2   3   2   0   1  33  0.51 1.91
+  106 M    1 -2  2 -2 -2 -1 -2  5 -1 -1 -3 -3  0 -2 -4  0  1 -1 -2 -2    9   3   9   2   1   3   2  37   1   3   3   1   3   2   0   6   8   1   1   2  0.50 1.88
+  107 L    0 -4 -1 -2 -1  0 -2 -2 -1  1 -1 -3  2  2  0  2  2 -1  2  0    7   1   3   2   1   5   3   4   1   8   6   1   5   8   4  14  14   1   6   6  0.18 1.81
+  108 A   -1 -3  2  6 -5  0 -1 -2 -1 -3 -3 -1 -4 -3 -3  1 -1 -5 -5 -2    6   1   9  47   0   4   2   3   1   1   3   3   0   2   1   8   4   0   0   3  0.85 1.88
+  109 A    2 -2  5  1 -5 -1  0  1  0 -3 -3 -3 -2 -1 -2  0 -2 -1 -2 -2   16   2  29   7   0   3   5   9   2   1   3   0   1   3   3   7   3   1   1   3  0.47 1.89
+  110 T    0  1 -1 -1 -4 -1  1 -3  0 -1 -2  1 -2  2 -2 -1  1 -2  4  1    8   7   3   3   0   3   8   2   2   4   4   8   1   7   2   4  11   1  14  11  0.22 1.77
+  111 K    1  1 -1  0 -5  3  3 -1  0 -4 -2  2 -2 -3 -2 -1 -2 -1 -2 -2   14   6   3   5   0  12  16   4   2   1   5  15   1   1   2   4   3   1   2   3  0.30 1.80
+  112 I    2 -4 -2 -3 -2 -2 -2  2 -1  2  0 -3  1  0 -3  0 -2 -1 -1  1   19   1   2   2   1   2   3  17   2  14   8   1   3   4   1   7   2   1   2   9  0.27 1.75
+  113 G    1 -4 -1  0 -2 -4 -4  6 -4 -3 -4 -4 -2 -2 -4 -2 -2 -5 -5 -3   10   0   2   5   1   0   1  65   0   2   2   1   1   2   1   3   3   0   0   2  1.22 1.76
+  114 E    1  2  0 -2 -1  1  2 -3  0 -1 -2  1 -1 -1 -2 -2 -1 -1  1  0   13  11   5   2   1   7  15   2   3   4   4   8   1   3   2   3   4   1   5   7  0.19 1.83
+  115 R    0  1 -2  1 -5  2  0 -3 -1  2  2  0  3 -2 -3 -2 -1 -1 -1 -1    8   7   2   7   0   9   7   2   1  10  18   7   7   1   1   2   3   1   2   4  0.19 1.85
+  116 Q    3 -3 -1 -2  0  4 -1 -2 -2  0  0 -2  1 -2 -3 -2  0 -1 -2  1   23   1   2   2   2  21   4   3   1   5   8   2   3   2   1   2   5   1   1  11  0.35 1.86
+  117 G    3 -5 -2 -3  2 -4 -5  5 -2 -2 -2 -4  0 -3 -3 -2  0  0 -2 -1   24   0   2   1   4   0   0  41   1   2   4   0   3   1   1   1   7   2   2   4  0.75 1.90
+  118 Q    0  1  0  1 -5  3  3 -1  1 -5 -3  2  0 -5 -2 -1 -1 -5 -2 -2    9   8   3   9   0  11  19   6   4   0   3  11   2   0   1   4   4   0   1   3  0.35 1.89
+  119 E    1 -1 -1 -2 -5  0  2 -2  2 -1  1 -1  0  1 -5 -2 -2  3  5 -3   10   4   3   2   0   4  12   3   5   3  14   3   3   6   0   3   2   3  19   2  0.37 1.90
+  120 L    0 -5 -4 -5  0 -5 -3 -3 -2  3  4 -5  4  0 -5 -3 -3  0 -2  1    8   0   1   0   2   0   2   3   1  16  40   0  10   3   0   2   1   1   1   7  0.69 1.89
+  121 Y    4 -3 -4 -3  1 -3 -2 -1 -2  2  0 -1 -1 -1 -4 -1 -2  0 -1  3   33   1   0   1   3   1   3   4   1  10   8   4   1   2   0   3   2   2   2  18  0.44 1.87
+  122 K    1  0  0  3 -5  0  2 -1 -1 -2 -3  4 -2 -2 -3 -1 -1 -1 -2 -3   10   5   5  14   0   4  13   5   2   3   2  23   1   2   1   5   3   1   1   2  0.35 1.82
+  123 E    1  0 -2  0  1  1  2 -3  4 -2  1  1 -1 -3 -2 -1  0 -2  0 -2   10   5   1   4   3   6  14   2   9   2  14  10   1   1   2   4   5   1   3   3  0.21 1.82
+  124 M    0 -2 -3 -4 -2 -3 -4  0 -1  1  3 -1  5  0 -4 -3 -2  4  1  0    9   2   1   1   1   1   1   7   2   6  28   3  12   4   1   2   3   5   4   7  0.42 1.79
+  125 Q    0 -1  2 -2 -1 -1 -1  3  2 -1 -1  2 -1 -4 -1 -2 -1 -4 -2 -2    8   2   9   2   1   3   3  24   6   3   7  15   1   1   4   2   5   0   1   3  0.32 1.76
+  126 K    1  2  1  0 -2 -1  1  3  1 -4 -2  2 -2 -4 -2 -1 -1 -4 -2 -3   11  10   6   5   1   2  10  18   4   1   4  13   1   1   2   5   3   0   1   2  0.28 1.75
+  127 R   -1  3  1  0 -2  1  0 -1  2 -3 -2  4 -2 -4 -2  0 -1 -4 -2 -3    4  16   6   5   1   6   5   4   4   2   5  26   1   1   2   7   3   0   2   2  0.40 1.70
+  128 G    0 -2 -1 -2 -2 -1 -2  5 -1 -2  0  0 -1 -2 -1 -2 -2 -3 -2 -2    8   3   3   2   1   3   3  42   2   2   9   5   2   2   3   3   2   0   2   3  0.51 1.55
+  129 W    0 -1  2  0  0 -1  0  1  0  0  0  0 -1  0 -1  0 -1  4 -1 -1    8   3  10   6   2   2   6   9   2   5  10   6   2   4   4   7   4   5   2   4  0.08 1.34
+  130 D   -1 -1  1  3 -1  0  0 -1  1 -1 -2  2 -2 -1  0 -1 -1  0  1 -1    6   3   7  17   1   3   6   6   3   4   4  12   1   3   4   4   3   1   6   6  0.17 1.42
+  131 V    0 -2 -2 -2  0 -2 -2  0 -1  0  1  0  0 -1  2 -1 -1  0 -2  2    8   2   2   3   2   2   3   9   1   6  13   6   2   2  11   4   4   1   1  16  0.15 1.45
+  132 K    1 -1  2 -1 -1 -1  1  3  1 -2 -2  2 -1 -3 -1 -1 -1 -3 -2 -1   10   3  10   3   1   3   9  18   4   3   4  12   1   1   3   4   4   0   1   5  0.21 1.55
+  133 E   -1  0  0  0 -2  0  1  2  3 -1 -1  2 -1  0  0 -1 -1 -3  0 -1    5   4   4   6   1   3   9  13   7   4   6  12   1   4   4   4   4   0   3   4  0.13 1.59
+  134 S   -1  0  0  2 -2  0  0 -2  0  2 -1  0 -2 -1 -1 -1  0 -1 -2  2    4   6   5  10   1   5   6   3   2  12   6   6   1   3   3   4   7   1   1  14  0.12 1.69
+  135 A    0  0  0 -2 -2 -1  0  4 -2  1 -3  1 -2 -2 -3 -2 -3 -3  2  1    8   6   5   2   1   3   7  27   1   8   2   8   1   2   1   2   1   0   7   9  0.32 1.83
+  136 V    2 -3 -2 -4  0 -4 -4  1 -2  4  0 -2  1  0 -4 -2 -2 -2 -2  3   16   2   2   1   2   0   1   9   1  23   9   3   3   4   1   3   1   1   1  17  0.41 1.93
+  137 M    2 -4 -4 -5 -1 -3 -1 -2 -2  4  2 -3  2  1 -2 -3 -2 -5 -2  2   16   1   1   0   1   1   4   3   1  20  21   1   5   5   2   1   2   0   1  15  0.46 1.94
+  138 A    0 -2 -2 -2  1  1 -2  0  0  3  1 -3  1  1  0 -1 -2 -5 -1  1    7   3   2   3   3   6   2   7   2  16  15   1   3   5   5   4   3   0   2  10  0.18 1.93
+  139 I   -1 -3 -1 -3 -1 -2 -1 -1 -1  3  2 -2  3  2 -4 -1  0 -3  1  1    5   1   4   1   2   2   5   6   1  18  16   2   6   8   1   4   5   0   5   8  0.23 1.88
+  140 T    0 -2  0 -1 -3 -1  0  4 -1 -2 -2 -3 -2 -1 -1  1  2 -3 -3  0    9   2   5   3   1   3   6  28   1   2   5   1   1   2   3   9  12   0   1   6  0.31 1.88
+  141 A    0 -3  0 -1 -3  0 -1  4  0 -1  0 -2  1 -1  0  0 -2 -1  1 -1    8   1   5   3   0   4   4  27   2   3   8   2   3   2   5   7   3   1   4   5  0.23 1.81
+  142 N   -1 -1  1  2 -3  0 -1 -2 -1 -2  1 -2 -2 -1  4  1  0 -4 -1 -2    5   3   6  11   0   4   3   3   1   2  13   2   1   2  20  12   5   0   3   3  0.29 1.86
+  143 E   -1 -2 -1  0 -3  2  1  2 -1 -3 -3  1 -2 -2  2  1  1 -1 -1 -3    5   2   3   4   0   8   9  17   1   1   2   9   1   2  10  11   8   1   2   1  0.25 1.92
+  144 L    0 -1  1  0 -5 -1 -2  1  3 -1  0 -1  0 -1 -1  0  0  1 -1  1    9   3   7   6   0   3   3  11   7   4  10   3   2   3   3   7   7   2   2   9  0.10 1.96
+  145 D   -1 -1  1  1 -5  0  0 -1  1 -1 -1 -1  1 -1  3  1  0 -5  0 -1    5   3   6   9   0   4   6   5   3   4   6   3   3   3  14  12   6   0   3   5  0.15 1.94
+  146 T    0 -1  2  0  1 -1 -1 -1  1 -1 -2 -1 -4 -1  0  1  2  2  0  0    8   3  11   5   3   3   4   4   3   3   5   3   0   3   5  12  12   3   3   7  0.15 1.95
+  147 A    4 -2  0 -1  1  0 -3  1  1 -1 -2 -3 -1 -3 -2  0  0 -5 -2  0   35   2   4   3   3   5   1   8   3   3   5   1   1   1   2   8   7   0   1   7  0.35 1.90
+  148 R   -1  2  1  1 -2  3  0 -1  1  1 -2  1  0 -2 -5 -2  0  0 -1  0    5  10   7   8   1  12   7   5   3   7   3  10   3   1   0   2   6   1   2   6  0.19 1.88
+  149 R    1 -1  1  2 -5  3  1 -2 -1  0  0 -1  1 -1 -2 -1 -2  0 -2 -3   10   3   6  12   0  14  10   3   2   6  11   4   3   3   2   4   2   1   1   2  0.21 1.88
+  150 R   -3  7 -1 -4 -5  0 -2 -3 -1 -2 -3  0 -4  0 -5 -2 -2  4 -2 -2    2  58   3   0   0   3   2   2   1   3   3   4   0   4   0   2   2   6   1   3  1.14 1.84
+  151 T    0  1  0 -2  1 -2 -1 -2  0  0  0  0 -1  0 -5 -1  3  3  1  1    7   7   5   2   3   2   5   3   2   6   8   5   1   3   0   5  16   5   5  12  0.18 1.84
+  152 T    0  0  1  3 -5  2  3 -2  0 -2 -3  3  0 -5 -4 -1  0  1 -2 -3    9   4   5  14   0   8  16   3   2   3   3  16   3   0   0   4   5   2   1   2  0.35 1.81
+  153 G   -1 -3 -2 -2 -1 -2 -1  6 -1 -2 -4 -3 -5 -2 -5 -1 -3  3  2 -3    4   2   2   2   2   2   3  57   1   3   2   1   0   1   0   4   2   4   6   2  0.97 1.84
+  154 S    1 -5 -2 -5  1  1 -2 -3  0  1 -2 -4  1  4 -3 -1 -2  2  3  1   14   0   2   0   2   6   3   2   2   8   3   0   3  20   2   4   3   3  11  11  0.44 1.84
+  155 M   -2  2 -1 -2 -2  1  0 -4  1  2  0  4  3 -2 -4 -3 -1 -1 -2  0    3   9   2   3   1   5   7   1   4  10   9  22   8   2   0   1   3   1   1   6  0.32 1.83
+  156 D   -1  0  0  3 -2  2  3 -2 -1 -4 -3  3  0 -5 -2  1 -2 -5 -2 -5    6   4   3  16   1  10  17   4   1   1   3  17   3   0   2   9   2   0   1   0  0.43 1.85
+  157 A    4 -3 -1 -3 -2 -2  0  0 -3 -1 -3 -2 -2 -3 -2 -2  1 -1  0  3   35   1   3   1   1   1   6   7   1   3   1   2   1   1   2   3   8   1   3  18  0.44 1.90
+  158 L   -1 -3 -3 -4 -1 -3 -3 -5 -1  2  4 -2  4  3 -5 -4 -3 -4  0  0    6   1   1   1   1   1   1   0   1  13  40   3  10  11   0   0   1   0   3   4  0.68 1.87
+  159 K    0  1  1  1 -4  1  1 -2 -2  0 -3  4 -2 -3 -2 -1 -1 -4 -2 -1    9   6   7   9   0   6   9   3   1   5   3  25   1   1   2   4   3   0   2   5  0.31 1.75
+  160 A    2 -1  0  1 -4  0  3 -1 -1 -2 -2  2  0 -3 -1 -1 -1 -2 -2 -2   18   3   4   8   0   4  18   5   1   2   4  14   3   1   3   3   3   1   2   3  0.27 1.73
+  161 A   -1  0  0  0  3  1  0 -1  2  0 -1  0  2  1  0 -1  0 -5  1 -1    5   5   5   5   5   5   5   5   5   5   5   5   5   5   5   5   5   0   5   5  0.07 2.01
+  162 G   -2 -1  0  2  0  0  0  4  0 -2 -3  0 -1 -2 -1  0 -2  1 -1 -2    4   3   5  12   2   5   5  28   2   2   3   7   2   2   3   6   3   2   3   3  0.31 1.96
+  163 F   -1 -2 -2 -1  2  0 -1  0  2  2  0  0  0  1 -2 -1 -2  1  4 -1    5   2   2   4   4   4   3   7   4  10  11   6   3   6   2   5   3   2  12   4  0.16 1.95
+  164 P   -1 -1 -2  0 -4 -1  0  0 -4 -3 -3  2 -2 -3  6 -1 -1 -4 -2 -3    5   3   2   6   0   3   5   8   0   1   2  11   1   1  38   5   4   0   1   2  0.75 1.84
+  165 E   -1 -1  1  3 -3  1  2  0 -2 -1 -3  2 -4 -1  1 -2  1 -2 -2 -1    5   3   5  15   1   6  12   7   1   4   3  11   0   3   6   3   8   1   1   6  0.21 1.95
+  166 K   -1 -2 -2  1 -1  0  1 -2 -2  3 -1  0  4 -1 -1 -2 -2  1  0  1    6   2   2   9   1   4  10   4   1  15   6   6   9   2   4   3   2   2   3   8  0.18 1.98
+  167 Q   -2  1  3  1 -2  2  2 -2  1 -4 -3  3 -2 -3  0 -1 -1  0 -1 -2    4   6  12   7   1   9  12   2   4   1   2  21   1   1   4   4   4   2   2   3  0.36 2.02
+  168 I   -2 -2 -3 -3 -2 -3 -1 -3 -5  5  2 -3  1 -2 -2 -2 -2 -5 -1  4    2   3   1   2   1   1   5   2   0  28  17   2   3   1   3   3   2   0   2  23  0.58 2.05
+  169 Y   -1 -2 -2 -1 -2 -2 -2 -4 -2  2  1 -3 -1  1 -3 -2 -2  2  2  4    5   2   2   4   1   2   3   2   1  10  14   2   1   5   2   2   2   3   6  33  0.44 2.01
+  170 Q    1  1 -2  1 -1  2  1  0  0 -1 -2  0 -4 -1 -2  0  0  2 -2  0   13   8   2   7   2   8   9   8   3   4   4   4   0   3   2   8   6   3   1   6  0.12 1.97
+  171 V    0 -1 -2 -1 -1  0  0 -2 -1  1  0 -1  0 -2 -1  0  1 -5 -2  3    9   3   2   4   1   5   7   3   2   7  10   4   3   2   3   8   8   0   1  18  0.13 1.98
+  172 P    0  0 -1  2 -4  4  1 -1  0 -1 -2 -1 -1 -2  2 -2 -2 -4  0 -1    8   4   2  12   0  20   8   4   2   3   3   3   2   2  11   3   3   0   4   5  0.31 1.88
+  173 T   -1 -1  0 -1 -1  1  1 -2  1 -1 -2 -2 -2  0 -1  1  3  1  2  0    6   4   4   3   1   5  10   4   3   3   3   2   1   3   3   9  20   2   8   6  0.20 1.98
+  174 K    3 -1  0  0  0 -2 -1  4 -2 -3 -2  0 -3 -3 -2  0 -1 -2 -5 -3   20   3   4   6   2   2   3  32   1   2   4   5   1   1   2   6   4   1   0   2  0.46 1.95
+  175 S   -2  0  3  4 -3 -1  1  1 -1 -3 -3  0  1 -1 -3 -1  0 -2 -2 -3    2   5  15  21   1   2  10   9   1   2   3   5   4   3   1   5   6   1   1   2  0.36 1.98
+  176 N   -2 -3  2 -2 -5 -2 -4 -1 -3 -3 -2 -4 -2  4 -2 -2  0  9  2 -3    4   1   9   3   0   2   1   5   0   1   4   1   1  17   3   3   7  31   5   1  1.14 2.01
+  177 D   -1 -2  1  5 -5  0  1 -3 -2 -1 -2 -1 -1 -3 -3  2  1 -5 -3 -2    4   2   5  28   0   4  10   2   1   4   3   4   2   1   1  15   9   0   1   3  0.45 1.89
+  178 I    0  3 -2 -2 -1  0  0 -2  0  1 -1  0  1 -1  2 -1  1 -5  0  0    9  15   1   2   1   5   7   3   2   7   6   4   3   3   9   4   8   0   4   6  0.15 1.91
+  179 P    1 -2  0  3 -1  1  4 -2 -1 -3 -3 -1 -2 -6  1  0  0 -2 -5 -3   14   2   4  14   1   6  25   2   1   1   3   3   1   0   8   6   6   1   0   2  0.43 1.93
+  180 G    0  0  0  0  0  1  1  2 -1 -2 -3  3 -2 -5 -3  1  0 -6 -2 -2    8   4   5   5   2   5   9  15   2   2   2  17   1   0   1  12   5   0   2   3  0.26 1.95
+  181 A    4 -3 -2 -3 -1 -3 -3  4 -1 -2 -4 -4 -5 -3 -5  1 -2 -6 -5 -2   41   2   2   1   1   1   1  32   1   2   1   0   0   1   0   8   2   0   0   2  0.89 1.96
+  182 F   -1  1 -1 -2 -1  2 -1 -2 -1  0  1  1  2  3 -5 -3 -2 -4  4 -1    5   6   3   2   2  10   4   3   1   4  13  10   5  12   0   1   3   0  14   4  0.31 1.96
+  183 D    1  1  1  3 -5  2  2 -2 -1 -2 -3  1 -2 -4 -2  1  0 -2 -2 -3   11   7   8  17   0   8  11   2   1   2   2   7   1   1   2  10   6   1   2   1  0.30 1.95
+  184 A    3  0 -1 -5  1  0 -2 -2 -5  1 -1  1 -1 -3 -3 -1 -1 -1 -1  2   26   5   3   0   3   4   3   2   0   9   6   8   1   1   1   5   3   1   2  16  0.30 1.93
+  185 A    3 -2 -3 -3  1 -2 -2 -3 -2  0 -1 -3  6 -1 -5 -2  2 -1 -2  1   26   2   1   1   3   2   2   2   1   6   4   1  22   2   0   2  12   1   1  10  0.59 1.92
+  186 N    0  0  2  1 -3  2  3 -2  0 -3 -2  1 -1 -4 -3  0  1 -3 -3 -3    7   5   8   8   1  11  22   2   2   1   4   8   2   1   1   7  10   0   1   2  0.34 1.89
+  187 S    1  0  3  2 -5  2  1 -1 -2 -2 -3  0 -2 -4 -2  1  1 -6 -3 -3   12   5  13  11   0   8   9   5   1   3   3   6   1   1   2  11   7   0   1   1  0.28 1.89
+  188 M    0 -3 -5 -6 -2 -3 -4 -5 -4  2  4 -3  3  1 -5 -4 -1  5  1  1   10   1   1   0   1   1   1   1   0  12  35   1   7   5   0   1   3   8   4   8  0.65 1.89
+  189 L   -4 -3 -6 -6 -5 -5 -4 -6 -3  2  6 -5  2  1 -6 -5 -3 -5 -1 -1    1   1   0   0   0   0   1   0   1  11  69   0   5   5   0   1   1   0   2   3  1.23 1.92
+  190 V    2  0  1 -1 -4  3  0 -2 -3 -3 -1  1 -4 -2 -2  1  3 -5 -4 -1   15   4   6   3   0  13   4   2   1   1   6   8   0   2   2  11  17   0   0   4  0.31 1.85
+  191 Q    3  1 -2 -1 -5  2  1 -1 -2 -4 -3  2 -2 -5 -4  2  0 -6 -5 -3   28   8   2   3   0   8   8   5   1   1   2  14   1   0   1  12   6   0   0   1  0.45 1.89
+  192 H   -3  0  4  1 -3 -1 -2  0  5 -3 -2 -2 -3  0  1 -2 -1 -2  3 -3    2   5  21   6   0   3   2   7  16   2   4   2   1   4   7   2   3   1  12   1  0.54 1.77
+  193 P   -1 -1  0 -2 -4  0 -2  0 -2 -3 -3  1 -4 -4  6 -1 -2 -5 -1 -3    5   3   5   2   0   4   2   8   1   1   2   8   0   1  45   5   2   0   3   2  0.92 1.74
+  194 E   -1 -1  2  5 -5  0  0  1 -1 -4 -3  1 -3 -5 -2  0  0 -5 -2 -4    5   4   9  31   0   5   6  11   1   1   3   7   1   0   2   5   6   0   2   1  0.49 1.76
+  195 V   -1 -2  1 -1 -1 -2 -2 -1 -2  3  2 -1  0  1 -1 -2 -1 -3 -2  2    6   2   6   3   1   2   2   5   1  19  18   4   2   6   3   3   4   0   1  13  0.25 1.56
+  196 K   -1  2  1  3 -2  0 -1 -3 -2 -3 -3  4 -4 -5 -1  0  1 -5 -4 -2    5  10   5  16   1   4   4   2   1   1   2  28   0   0   3   5   9   0   0   2  0.50 1.74
+  197 H    0 -2 -1 -2 -1 -1 -2  3  0  3 -2 -2 -2  0  3 -1 -2 -3 -2  0    8   2   4   2   1   3   3  19   3  15   4   3   1   4  14   4   3   0   1   6  0.26 1.37
+  198 W   -1 -2  0  2 -1 -1  1 -1 -2  0  0 -2  0  0 -2  0  2  3 -1  0    5   2   3  11   1   3  10   4   1   6   9   3   2   5   2   7  12   4   2   8  0.13 1.23
+  199 L    5 -4 -4 -4 -2 -3 -4 -1 -3  0 -1 -4 -1  1 -4 -2 -2 -2 -2  3   48   0   0   1   1   1   1   5   1   5   7   1   1   6   0   1   2   1   1  17  0.71 1.75
+  200 I    0 -5 -6 -5 -1 -4 -5 -3 -6  5  0 -5  0 -1 -3 -4 -1 -2 -3  5    7   0   0   1   1   1   0   2   0  35   8   0   2   2   1   1   3   1   0  34  0.94 1.88
+  201 V   -3 -5 -4 -4 -3 -3 -4 -3 -2  2  1 -5  0  6 -5 -4 -1  3  3  1    2   0   1   1   1   1   1   3   1  11  14   0   2  33   1   1   3   3  11  11  0.82 1.86
+  202 G    4 -5 -3 -4  5 -3 -3  2 -3 -4 -5 -4 -4 -4 -4  2  0 -2 -4 -2   39   0   1   1  12   1   1  16   1   1   0   0   0   1   1  18   6   1   0   3  0.83 1.86
+  203 M    2 -4  2 -3  2 -1 -2  2  2  0 -2 -4  1 -1  1  1 -1 -2  0 -2   20   0  11   1   4   3   2  14   5   5   4   0   3   3   6  10   3   1   3   3  0.28 1.85
+  204 N   -3 -2  7  0 -5 -2 -3 -1 -3 -3 -4 -3 -3 -3 -1  1 -1  2  1 -4    2   1  58   4   0   1   1   4   0   2   2   0   1   1   3   9   3   3   4   1  1.18 1.80
+  205 D   -2 -4 -1  7 -3 -3  0 -2 -1 -5 -5 -4 -2 -5 -4 -2 -2 -6 -3 -3    4   0   2  72   1   0   4   3   1   1   1   0   1   0   1   3   2   0   1   2  1.55 1.81
+  206 S    0 -2  0  1 -3  1  2  1 -2 -1  0 -3  1 -3  2  0 -1  0 -3 -1    7   2   5   9   0   6  13  12   1   4   9   1   3   1  11   6   4   1   1   5  0.17 1.84
+  207 T    0 -3 -4 -4 -2 -1 -4 -1 -5  1  0 -4  8 -1 -1 -2  1 -5 -2  0    9   1   1   1   1   3   1   5   0   7   8   0  41   2   3   3   9   0   1   5  0.89 1.83
+  208 V    6 -4 -4 -4 -2 -3 -4 -1 -3 -1 -2 -4 -1 -4 -2  0  0 -6 -5  0   65   0   0   0   1   1   0   4   1   3   3   0   1   1   2   5   5   0   0   7  1.02 1.87
+  209 L   -1 -2 -5 -3 -3 -3 -3 -2 -4  4  3 -3  3  0 -2 -4 -2 -5  0  1    6   2   0   2   0   1   2   4   0  23  29   1   8   3   3   1   2   0   4  10  0.53 1.86
+  210 G    0 -3 -3 -1 -5 -2 -4  7 -5 -5 -4 -4 -3 -4 -4 -3 -2 -5 -6 -4    7   2   0   3   0   2   1  76   0   0   1   0   1   1   1   1   3   0   0   1  1.56 1.85
+  211 G    5 -5 -4 -4 -2 -4 -4 -2 -5  1 -2 -3 -1 -3 -4 -2 -1 -6 -5  2   58   0   1   1   1   0   0   3   0   9   4   1   1   1   0   2   3   0   0  15  0.95 1.87
+  212 V    0 -4 -6 -4 -2 -3 -4 -1 -5  4  2 -4  3 -2 -4 -3 -3 -2  2  3    9   1   0   1   1   1   1   4   0  25  18   1   7   1   1   2   1   0   6  19  0.60 1.88
+  213 R    1  3  0  0 -2  3  2 -3 -1 -3 -2  2  0 -6 -3  0 -2 -6 -4 -4   10  18   4   5   1  15  11   2   1   2   4  13   2   0   1   7   3   0   0   1  0.43 1.87
+  214 A    6 -3 -4 -5 -2 -3 -3  0 -5 -3 -3 -3 -3 -4 -3  0 -2 -6 -2  0   70   1   0   0   1   1   1   6   0   1   2   1   1   0   1   7   2   0   1   6  1.15 1.87
+  215 T    2 -3 -4 -6  0 -3 -5 -4 -6  2  4 -4  1 -1 -3 -4 -1 -1 -3  2   16   1   1   0   2   1   0   1   0  12  39   1   3   3   1   1   4   1   1  13  0.63 1.89
+  216 E    0  3 -1  0 -6  2  2 -2  1 -3 -3  4 -3 -3 -5 -1 -3 -1 -1 -2    7  15   2   5   0   9  14   2   3   2   2  24   1   1   0   4   1   1   2   3  0.47 1.87
+  217 G    2  0  0  2 -5  3  4  0 -2 -5 -5  1 -3 -6 -3  0 -2 -6 -4 -4   16   4   4   9   0  15  26   6   1   0   1   7   0   0   1   6   2   0   0   1  0.58 1.87
+  218 Q    4  1 -1 -3 -3  1 -2 -3  1 -3  0  0  0 -2 -4  0 -2 -3  0 -1   37   9   4   1   1   7   2   1   4   1   9   6   2   1   0   6   1   0   3   4  0.43 1.87
+  219 G   -3 -2  2 -3 -5 -2 -4  6  0 -4 -4  0 -5 -4 -5 -2 -3 -5 -5 -4    1   2   8   1   0   1   1  71   2   1   2   5   0   1   0   2   1   0   0   1  1.41 1.81
+  220 F   -2  2 -3 -3 -4 -2 -3 -2 -2  2  3  0  0  0 -4 -1 -3 -2  2  0    3  13   1   1   0   1   1   3   1  12  29   7   2   4   1   4   1   1   8   6  0.38 1.65
+  221 K    0  3  0  0 -4  0  0 -1 -2 -3 -3  4 -3 -3  0  0 -1 -1 -4 -2    7  14   4   5   0   3   6   5   1   1   2  30   0   1   4   8   4   1   0   2  0.44 1.71
+  222 A    2 -1 -1 -2 -4 -2 -2  0 -3 -1 -2  0  1 -4  5 -1  0 -2 -3 -1   15   3   2   3   0   2   3   8   1   3   4   6   3   1  30   5   5   1   1   5  0.49 1.64
+  223 A   -1 -1 -1  3 -5  1  2  3  0 -3 -4  2 -4 -4  1 -2 -3 -3 -4 -4    5   3   3  18   0   5  14  23   3   2   1  10   0   1   7   2   1   0   1   1  0.48 1.70
+  224 D   -2 -2  2  5 -3  1  1 -2 -2 -3 -3  2 -3 -3 -3  0 -2 -5 -4 -2    2   2   9  35   1   7   8   3   1   2   2  13   1   1   1   6   2   0   0   3  0.64 1.66
+  225 I   -2 -3 -4 -1 -2 -2 -2 -3 -4  4  1  1  2 -1 -2 -2 -2 -4 -1  4    2   2   1   4   1   1   2   2   0  19  10   9   6   2   2   2   2   0   2  30  0.49 1.70
+  226 I    0 -2 -4 -3 -1 -1 -3 -2 -4  3  0  2  1 -1  0  2  0 -3 -2  1    8   2   0   1   1   2   1   3   0  15   9  11   3   3   5  19   5   0   1   9  0.25 1.73
+  227 G   -1 -4 -2 -2 -2 -2 -3  0 -1  3  0 -4  1 -2 -3 -1 -1 -3 -1  4    6   1   2   2   1   2   2   9   2  18  10   1   3   2   1   4   3   0   2  31  0.44 1.76
+  228 I   -1 -5 -5 -5 -3 -5 -4 -2 -5  5  0 -4 -1  0  0 -3 -1 -5 -1  5    5   0   0   1   0   0   1   3   0  30   6   1   1   3   4   2   3   0   2  35  0.81 1.81
+  229 G    0 -3 -2 -2 -2 -3 -4  6 -3 -2 -4 -2 -2 -3  1  0 -1 -5 -4 -1    7   1   2   2   1   1   1  55   0   2   1   2   1   1   8   5   3   0   0   5  0.92 1.80
+  230 I   -2 -5 -3 -3 -2 -4 -5 -4 -1  4 -1 -5 -2  5 -4 -3 -1 -1  3  3    4   0   1   2   1   1   0   1   1  24   5   0   0  27   1   1   3   1   9  18  0.83 1.85
+  231 N   -2 -4  1  6 -5 -3 -3  1 -4 -2 -4 -4 -4  1 -3 -1  1 -5 -3  0    3   0   5  49   0   1   0  10   0   2   1   0   0   6   1   4   9   0   1   7  0.92 1.79
+  232 G   -1 -4  2  2 -5 -4 -3  5 -4 -5 -4 -3 -3 -5 -4  1  0 -3 -4 -4    5   0  11  12   0   0   1  51   0   1   1   1   1   0   1   8   5   0   0   1  0.98 1.78
+  233 V   -1 -4 -1 -2 -3  2 -3 -3 -2  3 -1 -3  1  1 -2  1  2 -2  0  2    5   0   3   3   0   9   1   2   1  18   6   1   3   6   2  10  12   0   4  13  0.29 1.73
+  234 D   -2 -1  1  6 -5  1  2 -1 -1 -3 -4 -1 -4 -4  2 -2 -2 -5 -4 -3    2   3   6  43   0   5  11   5   2   1   1   2   0   1   9   2   2   0   0   2  0.81 1.66
+  235 A    4 -3 -2  3 -4 -1 -1  1 -3 -2  0 -3 -1 -1 -2 -1  0 -2 -2 -2   33   1   2  14   0   3   4  11   1   2   9   1   2   3   2   3   5   1   1   3  0.37 1.62
+  236 V    1 -4 -2 -4  1 -2 -2 -3 -3  3  2 -1  1 -1 -1 -2  0  0 -2  2   13   1   2   1   3   2   3   2   0  18  19   4   4   2   3   3   5   1   1  13  0.31 1.70
+  237 S    1  1  0  1 -3  0  0 -2 -2 -1 -3  1 -3 -5  4  1 -1 -5 -4 -2   14   8   4   7   0   5   7   3   1   3   3   8   0   0  19   9   3   0   1   2  0.34 1.77
+  238 E    2 -2 -1  2 -5  0  4  0 -4 -3 -3 -1 -2 -3  0  0 -1 -1  1 -3   15   2   3   9   0   4  29   6   0   2   2   3   1   1   5   6   4   1   5   2  0.39 1.79
+  239 L    1 -4 -3 -5 -2 -4 -4 -4 -3  1  3 -4  4  4 -5 -3 -2 -1  1  1   14   1   1   0   1   1   1   1   1   8  25   1  10  15   0   2   3   1   5  10  0.55 1.79
+  240 S    2  0 -2 -1 -2  2  0 -3 -3  1  1  2  1 -2 -3  0  0 -3 -3  0   16   5   2   3   1   9   5   2   0   7  11  12   3   1   1   7   7   0   1   7  0.17 1.77
+  241 K    1  1 -1  1 -5 -1  0 -2  0 -2  0  3  0 -3  0  1 -1 -1  0 -3   10   8   3   7   0   2   6   3   2   3  11  19   2   1   5  11   3   1   3   2  0.20 1.76
+  242 A    1 -2 -3 -3 -3 -2 -2  0 -5  3 -1 -2  0 -2  4 -2 -2 -3 -2  2   10   2   1   2   0   2   2   6   0  19   7   2   2   1  21   2   2   0   1  15  0.45 1.79
+  243 Q   -1  1  1  0 -4  0  1 -2 -3  1 -1  3  0 -4  0 -1  0 -2 -4 -1    6   8   6   4   0   4   8   4   1  10   6  21   2   0   4   4   7   1   0   5  0.22 1.70
+  244 A    2 -1  0  1 -4 -1  1 -3 -2 -2  1  1 -2 -4  2  2 -1 -3 -2 -2   14   3   4   8   0   2   8   2   1   2  13   9   1   0   9  16   3   0   2   2  0.21 1.69
+  245 T    0 -3 -1 -1 -4 -2 -2  5 -4 -3 -4 -1 -4 -4  1  0  3 -4 -4 -2    6   1   3   4   0   2   2  40   0   1   2   3   0   0   8   6  19   0   0   2  0.69 1.66
+  246 G    1 -1 -1  0 -2  0  1  2 -1 -2  0  0 -1 -2 -1 -1  0 -1 -1  0   10   3   2   6   1   5   8  18   2   3   8   6   2   2   3   4   7   1   2   8  0.11 1.40
+  247 F   -1 -3 -3 -3 -3  2 -2 -3 -3  3  2 -2  4  3 -3 -2 -2  1  0  1    4   1   1   2   0   8   3   2   1  19  17   2  10  10   1   3   2   2   3   8  0.38 1.46
+  248 Y    2 -2 -1  0 -1  1 -1 -2 -1 -1  1  0  0  0 -3 -1  0 -2  2  0   16   2   3   6   1   7   3   3   2   3  14   6   2   4   1   5   7   1   8   6  0.13 1.59
+  249 G    3 -3 -2 -3 -2 -1 -2  3 -3 -2 -3 -2  1 -1 -3  0  2 -1 -2  0   27   1   2   2   1   3   2  22   0   2   2   2   4   2   1   7  11   1   1   6  0.42 1.59
+  250 S    0 -4 -1 -3 -4 -3 -3 -3 -5 -2 -3 -4 -4 -3 -3  2  7 -5 -4 -1    6   1   2   1   0   1   1   2   0   2   2   0   0   1   1  12  63   0   0   4  1.16 1.84
+  251 L    0 -5 -6 -6 -4 -4 -5 -3 -4  4 -1 -5  2 -1 -4 -2 -3 -4 -2  5    8   0   0   0   0   0   0   2   0  24   3   0   5   3   1   3   1   0   1  47  0.99 1.85
+  252 L    2  0 -2  1 -5  0 -2 -1  2  0  1 -2  0  2 -4  0 -1  1  1  0   17   6   2   7   0   4   3   5   5   6  12   2   2   7   1   7   3   2   4   7  0.14 1.84
+  253 P   -4 -2  1 -3 -3  7 -2 -5 -3 -2 -2  1 -2 -2 -1 -1 -2  2  0 -3    1   0   6   0   1  57   1   0   0   3   4   7   1   2   4   3   3   3   3   1  1.15 1.85
+  254 S   -3 -1  3  4 -6  2 -2 -3 -1 -5 -5 -3 -4 -1  4  1 -2 -6 -1 -5    1   3  15  24   0  11   1   2   1   0   1   1   0   3  21  10   2   0   2   0  0.74 1.87
+  255 P    1 -3 -3 -4 -2 -2 -4 -3 -4  0 -3 -1  0 -2  6 -1  1 -3 -3  0   14   1   1   0   1   2   0   2   0   5   2   4   2   2  42   4   9   0   1   6  0.88 1.88
+  256 D    0  2 -1  1 -5  0  0 -1 -1 -1 -2  1 -3  1 -1 -2 -1  1  4 -1    8  11   3   9   0   3   7   5   2   3   3   9   1   5   3   2   3   2  17   4  0.27 1.87
+  257 V    0  1  0  1 -5  1  2  0 -4 -1  1  1  2 -3 -4 -1 -2 -4 -3  0    8   8   4   8   0   7  15   7   0   4  12   7   5   1   1   4   2   0   1   6  0.18 1.85
+  258 H   -1 -4 -4 -4 -5  4 -1 -2  2  2  2 -3  6 -1 -5 -4 -3 -1 -1 -1    5   0   0   1   0  20   4   4   5  11  17   1  22   2   0   0   1   1   2   4  0.68 1.85
+  259 G    3 -5 -4 -5 -5 -5 -5  6 -4 -3 -6 -4 -3 -5 -5 -2 -4 -3 -6 -3   21   0   0   0   0   0   0  69   0   2   0   1   1   0   0   2   1   0   0   2  1.56 1.88
+  260 Y    0  2 -1 -1 -4  2  2 -2 -2 -2 -4  3 -4  0 -3 -2 -2 -2  5 -3    8  11   3   3   0   8  15   3   0   3   1  15   0   3   1   3   2   0  18   2  0.46 1.86
+  261 K    2  0 -1 -1 -4  2  1 -1 -3  0  1  1  2 -3 -3 -2  0  0 -2  0   15   5   3   3   0   8   9   4   1   5  14   9   4   1   1   3   7   1   1   6  0.15 1.90
+  262 S    5 -5 -4 -5 -3 -2 -4  1 -5 -2 -2 -4 -1 -4 -1  1  2 -6 -5 -1   53   0   0   0   0   2   0   9   0   2   3   0   2   0   3  10  11   0   0   5  0.85 1.88
+  263 S    2 -4 -5 -6 -2 -4 -5 -3 -6  3  0 -4  2  2 -4 -3  0 -5 -2  5   20   1   0   0   1   1   0   2   0  13   7   0   4   7   1   1   5   0   1  36  0.70 1.89
+  264 E   -1  1  0  3 -4  3  3 -3 -2 -4 -2  1  0 -5 -3 -2  0 -2 -2 -2    5   8   4  16   0  13  20   2   1   1   5  10   3   0   1   2   5   1   2   2  0.42 1.85
+  265 M    1 -2  1 -4 -4  0 -4 -4  0  2  2 -3  4 -1 -5 -1  1 -4 -3  1   13   3   6   0   0   4   1   1   2  12  22   1  10   2   0   4   9   0   1   9  0.37 1.85
+  266 L    3 -5 -5 -5 -3 -5 -5 -1 -6  1  4 -5  4 -3 -5 -3 -3 -5 -3  1   29   0   0   0   0   0   0   5   0   6  37   0   9   1   0   2   1   0   1   9  0.77 1.87
+  267 Y    0 -3  0 -2 -3 -4 -2 -3  0  2  2 -1  2  1 -5 -2 -2  1  4  2    7   1   4   2   0   0   2   2   2  12  21   4   4   4   0   2   3   2  13  14  0.34 1.83
+  268 N    1  1  2  3 -5  2  2 -2 -1 -5 -3  3 -3 -5 -5 -1 -2 -3 -4 -4   11   7   9  19   0   7  14   2   1   0   3  17   1   0   0   4   2   0   1   1  0.50 1.85
+  269 W    0  2 -2 -4 -3  0 -2 -3  0  0  3 -1  2  0 -3 -2 -2  4  3 -1    8  12   2   1   1   3   2   2   3   4  27   4   4   3   1   2   2   5  10   3  0.35 1.69
+  270 V    1 -3 -4 -5 -2 -3 -4 -4 -4  5  3 -2  1 -2 -5 -3 -3 -5 -2  2   12   1   1   0   1   1   1   1   0  35  23   3   2   1   0   2   1   0   1  14  0.73 1.80
+  271 A    2  1  1 -2 -4  0  0 -1 -1 -2  1  3 -1 -3 -4 -1  2 -4 -3 -1   18   7   6   2   0   3   5   4   2   2  12  16   1   1   1   5  11   0   1   4  0.23 1.65
+  272 K   -1 -2  4  2 -5  1  2  2 -1 -4 -4  3 -3 -5 -3  0  0 -5 -3 -5    5   2  17  10   0   5  12  14   2   1   1  17   1   0   1   7   5   0   1   1  0.46 1.73
+  273 D   -2 -3 -1  0 -4  0  0  6 -1 -5 -6  2 -5 -6 -1 -2 -3 -5 -5 -5    2   1   3   5   0   4   6  57   1   1   0  11   0   0   4   2   1   0   0   0  1.04 1.79
+  274 V   -2  0  0  0 -5  2  3 -2 -1 -3 -3  4 -4 -4 -2 -2  2 -3 -4  0    3   5   5   5   0   7  16   2   2   2   2  29   0   0   1   2  11   0   0   6  0.49 1.83
+  275 E    1 -1 -1  0 -5  0  3 -3 -2 -1 -2  3 -3 -5  0  0  1 -6 -2  0   12   3   3   4   0   4  18   1   1   4   4  20   0   0   4   5   9   0   1   7  0.31 1.81
+  276 P   -1 -3 -3 -2 -5 -1 -1 -3 -2  0  0 -1 -2 -2  6 -1 -2 -6 -3  2    5   1   1   2   0   2   3   2   1   6   8   3   1   1  43   4   2   0   1  13  0.84 1.79
+  277 P    1 -1 -2  1 -3  0  3 -1 -2 -3 -3  0 -2 -5  5 -1 -1 -5 -2 -1   13   3   2   7   0   3  16   4   1   1   3   6   1   0  26   4   3   0   1   5  0.50 1.75
+  278 K    1  1  1  0 -5  1  1 -1 -1 -3 -4  4 -4 -5  2 -1 -2 -6 -4 -1   11   8   6   4   0   5  10   5   1   1   1  24   0   0  12   5   2   0   0   4  0.40 1.76
+  279 F   -2  0  2  0 -5  0  2 -1 -1 -1 -1  0 -1  1 -2 -2  0  1  2  1    3   5   8   5   0   4  13   5   2   3   6   5   2   7   2   3   7   2   7  12  0.13 1.75
+  280 T   -2 -1 -2 -2 -4  1 -2 -4 -1  4 -1  1 -1 -2 -2 -1  3 -5 -2  2    2   4   2   3   0   7   2   1   1  21   5   7   1   1   2   4  21   0   2  14  0.38 1.72
+  281 E   -1 -1 -1  0 -4  2  1 -2 -1  2 -1 -2 -1 -1  1 -1 -1  0  0  1    5   4   3   6   0  10  11   4   2  14   5   2   1   3   6   5   3   1   4   9  0.14 1.63
+  282 V   -2 -3 -3 -1 -4 -3 -3 -4 -4  2  3 -3  0  1 -3 -4  0 -1  0  4    3   2   1   4   0   1   1   1   0  11  31   1   1   5   1   1   6   1   3  24  0.52 1.63
+  283 T   -2 -4 -1  0 -2 -1 -1 -3 -4  1  1 -1  2  0  1 -2  4 -4 -1  1    2   0   2   6   1   3   3   1   0   7  14   4   5   4   7   3  27   0   2   8  0.34 1.68
+  284 D   -1 -2 -1  4 -5  0  1  2  0 -3 -3 -1 -3 -5  3  1  1 -5 -4 -4    4   2   3  20   0   4   8  14   2   1   2   4   1   0  15   9   9   0   0   1  0.45 1.66
+  285 V    0 -4 -4 -3  1 -3 -4  1 -2 -1 -2 -1 -4 -1  5 -2  0 -5 -2  3    6   0   0   1   3   1   1  13   1   3   4   4   0   2  28   3   6   0   2  20  0.58 1.72
+  286 V   -1  0 -1 -2 -5  1  2 -3 -1  0 -3  2 -1 -2 -1 -2  3 -6 -4  2    4   5   3   2   0   6  14   1   1   5   2  13   2   2   3   2  19   0   0  18  0.35 1.78
+  287 L   -3 -4 -6 -6 -4 -5 -5 -5 -4  1  5 -3  1  2 -2 -3 -2 -4  0  1    2   1   0   0   0   0   0   1   0   8  57   2   2   8   2   2   2   0   3  11  0.91 1.77
+  288 I   -3 -4 -5 -6 -1 -5 -5 -6 -6  6 -1 -5  1 -2 -5 -4 -1 -2 -2  5    2   1   0   0   1   0   1   0   0  44   4   0   3   1   0   1   3   1   1  37  1.22 1.78
+  289 T   -2 -4 -1  1 -5 -2  0 -4 -2  1 -1 -1 -3 -5 -5 -1  6 -1 -4  0    2   0   3   7   0   1   6   1   1   7   5   3   0   0   0   2  52   1   0   7  0.83 1.78
+  290 R    0  6 -2 -4 -6  0 -3 -4 -2 -5 -5  5 -5 -6  1 -1 -3 -6 -4 -5    7  38   1   0   0   4   1   1   1   0   1  35   0   0   6   5   1   0   0   0  1.12 1.78
+  291 D    0 -2 -1  5 -6  0  4  0 -4 -5 -6 -1 -5 -6 -5 -1 -1 -7 -6 -5    8   2   2  38   0   4  29   6   0   0   0   4   0   0   0   5   3   0   0   0  0.97 1.76
+  292 N   -4 -4  8  0 -5 -2 -3 -4 -3 -6 -6 -1 -5 -6 -5  2  0 -7 -5 -6    0   0  72   4   0   1   0   0   0   0   0   3   0   0   0  15   5   0   0   0  1.75 1.70
+  293 F    2 -4 -5 -4 -1 -4 -3 -5 -5  2  0 -5 -1  1 -3 -4  1  1  2  4   16   1   0   1   1   1   1   0   0   9  10   0   1   5   1   0   9   2   7  35  0.60 1.65
+  294 K    2 -1 -1  2 -5  2  1 -1 -2 -5 -5  4 -2 -6 -2 -1 -2 -6 -5 -4   21   2   3  11   0   9   8   5   1   0   1  31   1   0   1   4   1   0   0   1  0.61 1.63
+  295 E    0 -1 -2  3 -5  3  3 -3 -1 -4 -5  2 -4 -6 -2  1  2 -6 -5 -2    8   2   1  14   0  13  23   1   2   1   0  10   0   0   2   9  11   0   0   3  0.54 1.60
+  296 E   -1 -3 -3 -1  0 -1  3 -5 -4  1 -1 -3 -2  2 -1 -3 -2 -4  4  3    6   1   1   3   2   2  18   0   0   8   4   1   1   7   3   2   2   0  14  25  0.46 1.54
+  297 L   -1  3 -5 -2 -5 -1  0 -4 -3  0  3 -2  0  0 -3 -3 -4 -3  5  0    4  16   0   2   0   2   6   1   0   5  28   2   2   2   1   1   0   0  23   5  0.58 1.49
+  298 E    2 -3 -1  0 -5  1  4 -4 -2 -1 -5  3 -4 -3 -1 -2 -1 -6 -5  0   21   0   3   4   0   4  25   0   1   4   0  22   0   1   3   2   4   0   0   7  0.52 1.46
+  299 K    1  1 -2  1 -5  1  2 -3 -4 -5 -3  5 -4 -6 -1 -2  0 -6 -5 -5   13   7   1   9   0   6  14   1   0   0   2  36   0   0   3   1   6   0   0   0  0.64 1.40
+  300 K   -2  2 -2  0 -5  0 -2 -2 -4 -1  0  4  3 -1 -1  0 -1 -5 -4 -3    3  11   2   6   0   3   1   3   0   4  11  31   9   3   3   6   4   0   0   0  0.41 1.26
+  301 G    1 -2 -3 -4 -5 -4 -4  7 -4 -5 -5 -4 -5 -5 -4 -2 -2 -5 -1 -1    9   2   0   0   0   0   0  78   0   0   0   0   0   0   0   1   2   0   3   5  1.45 1.10
+  302 L   -3 -4 -5 -5 -3 -4 -2 -5 -4  2  5 -4  3  2 -1 -2 -3 -4 -3 -1    0   0   0   0   0   0   4   0   0  12  65   0   7   7   3   3   0   0   0   0  0.85 0.86
+  303 G    3 -3 -2 -3 -3 -2 -3  5  3 -4 -4 -2 -3 -3 -3 -1 -2 -3  1 -3   38   0   0   0   0   0   0  44  11   0   0   0   0   0   0   0   0   0   7   0  0.79 0.51
+  304 G    2 -3 -1 -2 -2 -2 -2  4 -3 -3 -3 -2 -3 -4 -2  2  2 -4 -3 -2   23   0   0   0   0   0   0  41   0   0   0   0   0   0   0  16  21   0   0   0  0.60 0.32
+  305 K   -2  4 -1 -2 -4  0  0 -3 -2 -4 -3  6 -2 -4 -2 -1 -2 -4 -3 -3    0  22   0   0   0   0   0   0   0   0   0  78   0   0   0   0   0   0   0   0  0.93 0.32
+
+                      K         Lambda
+Standard Ungapped    0.1335     0.3147
+Standard Gapped      0.0410     0.2670
+PSI Ungapped         0.1492     0.3177
+PSI Gapped           0.0457     0.2670
diff --git a/src/ChangeLog b/src/ChangeLog
new file mode 100644 (file)
index 0000000..0931024
--- /dev/null
@@ -0,0 +1,148 @@
+2006-03-27  Akira KINJO  <akinjo@genes.nig.ac.jp>
+
+       * xpredmsub.c: ad hoc probability for each SS class prediction.
+
+2006-03-15  Akira KINJO  <akinjo@genes.nig.ac.jp>
+
+       * xpredmsub.c: Confidence level for SS improved.
+
+2006-03-15  Akira KINJO  <akinjo@genes.nig.ac.jp>
+
+       * xpredmsub.c: Confidence level for SS improved.
+
+2006-03-13  Akira KINJO  <akinjo@genes.nig.ac.jp>
+
+       * xpredmsub.c:
+       added routines for ensemble prediction by local-linear fit.
+
+       * xpredm.h, xpredm.c:
+       added big_wet: ensemble prediction by local-linear fit.
+
+2006-03-13  Akira KINJO  <akinjo@genes.nig.ac.jp>
+
+       * xpredmsub.c:
+       added routines for ensemble prediction by local-linear fit.
+
+       * xpredm.h, xpredm.c:
+       added big_wet: ensemble prediction by local-linear fit.
+
+2006-03-13  Akira KINJO  <akinjo@genes.nig.ac.jp>
+
+       * xpredmsub.c:
+       added routines for ensemble prediction by local-linear fit.
+
+       * xpredm.h, xpredm.c:
+       added big_wet: ensemble prediction by local-linear fit.
+
+2006-03-09  Akira KINJO  <akinjo@genes.nig.ac.jp>
+
+       * xpredm.c: static big arrays.
+
+2006-03-09  Akira KINJO  <akinjo@genes.nig.ac.jp>
+
+       * xpredm.c: static big arrays.
+
+2006-02-21  Akira KINJO  <akinjo@genes.nig.ac.jp>
+
+       * xesn.h: CONV_LIM changed: 1.e-6 -> 1.e-3.
+
+2006-02-21  Akira KINJO  <akinjo@genes.nig.ac.jp>
+
+       * xesn.h: CONV_LIM changed: 1.e-6 -> 1.e-3.
+
+2006-02-20  Akira KINJO  <akinjo@genes.nig.ac.jp>
+
+       * Makefile: removed mtwister.
+
+       * Makefile: ranlib removed.
+
+       * chkaccu.h: note.
+
+       * Makefile: New file.
+
+       * xpredmsub.c: added note.
+
+       * xpredmsub.c, xpredm.h: New file.
+
+       * xpredm.c: added note.
+
+       * xpredm.c, xesn.h: New file.
+
+       * xesn.c: added note.
+
+       * xesn.c, sov.h: New file.
+
+       * sov.c: added note.
+
+       * sov.c: New file.
+
+       * secdp.c: added vcid[].
+
+       * secdp.c: New file.
+
+       * lpredm.c: added vcid[].
+
+       * lpredm.c: New file.
+
+       * crndump.c: added vcid[].
+
+       * crndump.c, chkaccu.h: New file.
+
+       * blast.c: added vcid[].
+
+       * blast.c: New file.
+
+       * chkaccu.c: added vcid[].
+
+       * chkaccu.c: New file.
+
+       * blast.h: added vcid[].
+
+       * blast.h: New file.
+
+2006-02-20  Akira KINJO  <akinjo@genes.nig.ac.jp>
+
+       * chkaccu.h: note.
+
+       * Makefile: New file.
+
+       * xpredmsub.c: added note.
+
+       * xpredmsub.c, xpredm.h: New file.
+
+       * xpredm.c: added note.
+
+       * xpredm.c, xesn.h: New file.
+
+       * xesn.c: added note.
+
+       * xesn.c, sov.h: New file.
+
+       * sov.c: added note.
+
+       * sov.c: New file.
+
+       * secdp.c: added vcid[].
+
+       * secdp.c: New file.
+
+       * lpredm.c: added vcid[].
+
+       * lpredm.c: New file.
+
+       * crndump.c: added vcid[].
+
+       * crndump.c, chkaccu.h: New file.
+
+       * blast.c: added vcid[].
+
+       * blast.c: New file.
+
+       * chkaccu.c: added vcid[].
+
+       * chkaccu.c: New file.
+
+       * blast.h: added vcid[].
+
+       * blast.h: New file.
+
diff --git a/src/Makefile b/src/Makefile
new file mode 100644 (file)
index 0000000..a371602
--- /dev/null
@@ -0,0 +1,49 @@
+NDIM=5000
+NILEVEL=1
+CC = gcc
+COPT = -O3 -Wall 
+INCDIR = 
+LIBDIR = 
+RANLIB = echo
+LIBS = libcrn.a -lm
+CFLAGS = $(COPT) -DNDIM=$(NDIM) -DNI_LEVEL=$(NILEVEL) \
+       $(INCDIR) $(LIBDIR)
+LFLAGS = -framework vecLib
+LIBCRN = libcrn.a
+OBJS = eprintf.o blast.o xesn.o chkaccu.o sov.o secdp.o
+PROGS = xpredm$(NDIM) lpredm
+INSTALL_DIR = ../bin
+
+all: $(LIBCRN) $(PROGS)
+install: all
+       mkdir -p $(INSTALL_DIR)
+       cp $(PROGS) ../bin
+xpredm$(NDIM): xpredm.o xpredmsub.o $(LIBCRN)
+       $(CC) $(CFLAGS) xpredm.o xpredmsub.o $(LIBS) -o xpredm$(NDIM)
+lpredm: lpredm.o xpredmsub.o $(LIBCRN)
+       $(CC) $(CFLAGS) lpredm.o xpredmsub.o $(LIBS) -o lpredm
+xpredm.o: xpredm.c xpredm.h $(LIBCRN)
+       $(CC) -c $(CFLAGS) xpredm.c
+lpredm.o: lpredm.c xpredm.h $(LIBCRN)
+       $(CC) -c $(CFLAGS) lpredm.c
+xpredmsub.o: xpredmsub.c xpredm.h $(LIBCRN)
+       $(CC) -c $(CFLAGS) xpredmsub.c
+libcrn.a: $(OBJS)
+       ar r libcrn.a $(OBJS)
+       $(RANLIB) libcrn.a 
+blast.o: blast.h blast.c  
+       $(CC) -c $(CFLAGS) blast.c
+eprintf.o: eprintf.h eprintf.c  
+       $(CC) -c $(CFLAGS) eprintf.c
+xesn.o: xesn.h blast.h xesn.c
+       $(CC) -c $(CFLAGS) xesn.c
+chkaccu.o: chkaccu.h blast.h chkaccu.c
+       $(CC) -c $(CFLAGS) chkaccu.c
+sov.o: sov.h blast.h sov.c
+       $(CC) -c $(CFLAGS) sov.c
+secdp.o: secdp.c blast.h
+       $(CC) -c $(CFLAGS) secdp.c
+clean:
+       -rm -f $(PROGS) *.o libcrn.a
+realclean: clean
+       (cd $(INSTALL_DIR); rm -f $(PROGS))
diff --git a/src/blast.c b/src/blast.c
new file mode 100644 (file)
index 0000000..ed4f72a
--- /dev/null
@@ -0,0 +1,283 @@
+/*     $Id: blast.c,v 1.2 2006/02/20 08:31:42 akinjo Exp $      */
+
+#ifndef lint
+static char vcid[] = "$Id: blast.c,v 1.2 2006/02/20 08:31:42 akinjo Exp $";
+#endif /* lint */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <ctype.h>
+#include <string.h>
+#include <math.h>
+
+
+#include "eprintf.h"
+#include "blast.h"
+
+const char amino1[] = "ARNDCQEGHILKMFPSTWYV";
+
+enum {MAXBUF = 201, MAXLINE=300};
+
+/* undef this if PSI score matrix is to be used instead of AA frequency.*/
+/*#define FREQPROF 0*/
+
+#ifdef FREQPROF 
+/* reading __frequency__ profile */
+#define WIDENT 4
+#define OFFENT 70
+#define SCAENT 0.01
+#else
+/* reading psi __score__ profile */
+#define WIDENT 3
+#define OFFENT 9
+#define SCAENT 1.0
+#endif
+
+static void get_compo(pssm_t *x)
+{
+  int i,ind;
+
+  for(i=0; i<20; i++) x->compo[i] = 0.0;
+  for(i=0; i<x->len; i++) {
+    ind = strchr(amino1, x->seq[i]) - amino1;
+    if(ind>=0) {
+      x->compo[ind] += 1.0;
+    }
+  }
+
+  for(i=0; i<20; i++) x->compo[i] /= x->len;
+
+  return;
+}
+
+static void get_wlcompo(pssm_t *x)
+{
+  int i,j,ind;
+  double lsep, lsep0;
+
+  for(i=0; i<x->len; i++) 
+    for(j=0; j<20; j++) 
+      x->wlcompo[i][j] = 0.0;
+
+  for(i=0; i<x->len; i++) {
+    lsep0 = 0.0;
+    for(j=0; j<x->len; j++) {
+      lsep = abs(i-j);
+      if (lsep < 2) continue;
+      lsep = log(lsep);
+      lsep0 += lsep;
+      ind = strchr(amino1, x->seq[j]) - amino1;
+      if(ind>=0) {
+       x->wlcompo[i][ind] += lsep;
+      }
+    }
+    for(j=0; j<20; j++) 
+      if(x->compo[j]>0.0) {
+       x->wlcompo[i][j] = (x->wlcompo[i][j]/(lsep0 * x->compo[j]));
+      }/*
+      else {
+       x->wlcompo[i][j] = 1.0;
+       }*/
+  }
+
+
+  return;
+}
+
+
+/* read PSI-Blast profile */
+void read_pssm(const char *fname, pssm_t *x)
+{
+  FILE *ic;
+  char line[MAXBUF]; 
+  char subline[MAXBUF];
+  int i,j;
+  char aa;
+
+  for(i = 0; i < MAXSEQ; i++) {
+    for(j = 0; j < 21; j++) {
+      x->prof[i][j] = 0.0;
+    }
+  }
+      
+  if((ic = fopen(fname,"r")) == NULL) {
+    eprintf("read_pssm: cannot open profile :%s:\n", fname);
+  }
+
+  i=0;
+  while(fgets(line,MAXBUF,ic)!=NULL) {
+    if(strlen(line)< 150) continue;
+    if(!isdigit(line[4])) continue;
+
+    aa = x->seq[i] = line[6];
+
+    for(j = 0; j < 20; j++) {
+      strncpy(subline,line+OFFENT+j*WIDENT,WIDENT);
+      x->prof[i][j] = (SCAENT*atof(subline)); 
+    }
+    i++;
+    if(i>= MAXSEQ) {
+      eprintf("read_pssm: maximum sequence length (%d) exceeded in %s\n",
+             MAXSEQ, fname);
+    }
+  }
+
+  fclose(ic);
+
+  x->len = i;
+
+  get_compo(x);
+  get_wlcompo(x);
+
+  return;
+}
+
+#undef WIDENT 
+#undef OFFENT 
+
+void read_ans(const char *fname, ans_t *ans)
+{
+  FILE *ic;
+  char line[MAXBUF]; 
+  int i;
+  int ires, len;
+  char aa,sec;
+  int nh,ne,nc;
+  double acn,scn,aco,sco;
+  double cn,rwco;
+
+  if((ic = fopen(fname,"r")) == NULL) {
+    eprintf("read_ans: cannot open profile :%s:\n", fname);
+  }
+
+  ans->len = 0;
+  for(i = 0; i < MAXSEQ; i++) {
+    ans->svec[i][0] = ans->svec[i][1] = ans->svec[i][2] = 0.0;
+  }
+
+  i=0;
+  while(fgets(line,MAXBUF,ic)!=NULL) {
+    if(line[0] == '#') {
+      sscanf(line, "# %d %d %d %d %lf %lf %lf %lf", 
+            &len, &nh, &ne, &nc, &acn,&scn,&aco,&sco);
+      ans->nh = nh;
+      ans->ne = ne;
+      ans->nc = nc;
+      ans->ave_cn = acn;
+      ans->sd_cn = scn;
+      ans->ave_co = aco;
+      ans->sd_co = sco;
+      continue;
+    }
+    sscanf(line, " %d %c %c %lf %lf", &ires, &aa, &sec,&cn,&rwco);
+    ans->ss[i] = sec;
+    if(sec == 'H') {
+      ans->svec[i][0] =  1.0;
+    }
+    else if(sec == 'E') {
+      ans->svec[i][1] =  1.0;
+    }
+    else {
+      ans->svec[i][2] =  1.0;
+    }
+    ans->nvec[i] = cn;
+    ans->ovec[i] = rwco;
+    
+    i++;
+    if(i>= MAXSEQ) {
+      eprintf("read_ans: maximum sequence length (%d) exceeded in %s\n",
+             MAXSEQ, fname);
+    }
+  }
+
+  if(i != len) {
+    eprintf("read_ans: sequence length inconsistent: %d %d\n", len, i);
+  }
+  
+  ans->len = i;
+
+  fclose(ic);
+
+  return;
+}
+
+void pssm2iunit(const int window, const int ind, const pssm_t *apssm, 
+                double iunit[])
+{
+  int is, ie, i, j, n, nunits;
+  static const double term[] = {0.0,0.0,0.0,0.0,0.0,0.0,0.0,0.0,0.0,0.0,
+                               0.0,0.0,0.0,0.0,0.0,0.0,0.0,0.0,0.0,0.0,
+                               1.0};
+
+  is = ind - window;
+  ie = ind + window;
+  nunits = (2*window + 1)*21 + 1;
+
+  for(n=0; n <nunits; n++) iunit[n] = 0.0;
+
+  n=0;
+  for(i = is; i <= ie; i++) {
+    if(i<0 ||i >= apssm->len) {
+      for(j = 0; j < 21; j++) {
+       iunit[n++] = term[j];
+      }
+    }
+    else {
+      for(j=0; j < 20; j++) {
+       iunit[n++] = apssm->prof[i][j];
+      }
+      iunit[n++] = (i==ind) ? 1.0 : 0.0;
+    }
+  }
+
+#if (NI_LEVEL==1 || NI_LEVEL==3)
+  /* amino acid composition */
+  for(j=0; j<20; j++) {
+    iunit[n++] = apssm->compo[j];
+  }
+#endif
+#if (NI_LEVEL==2 || NI_LEVEL==3)
+  for(j=0; j<20; j++) {
+    iunit[n++] = apssm->wlcompo[ind][j];
+  }
+#endif
+
+  return;
+}
+
+int read_file_list(char list[], mydata_t *adata)
+{
+  FILE *ic;
+  char line[MAXLINE];
+  char f1[MAXLINE],f2[MAXLINE], f3[MAXLINE];
+  int n=0;
+  long ndata=0;
+  if((ic = fopen(list,"r")) == NULL) {
+    eprintf("read_file_list: cannot open file: %s\n", list);
+  }
+
+  while(fgets(line,MAXLINE,ic) != NULL) {
+    if(line[0] == '#') continue;
+    sscanf(line,"%s %s %s", f1,f2,f3);
+
+    read_ans(f1, adata->ans + n);
+    read_pssm(f2, adata->pssm + n);
+    adata->pssm[n].fname = estrdup(f2);
+    adata->xxfile[n] = estrdup(f3);
+
+    ndata += (long) adata->pssm[n].len;
+    n++;
+    if(n>= MAXFILES) {
+      eprintf("read_file_list: maximum number of files exceeded: MAXFILES=%d\n",
+              MAXFILES);
+    }
+  }
+
+  fclose(ic);
+  adata->nent = n;
+  adata->ndat = ndata;
+
+  return n;
+}
+
diff --git a/src/blast.h b/src/blast.h
new file mode 100644 (file)
index 0000000..93fdb34
--- /dev/null
@@ -0,0 +1,87 @@
+#ifndef __blast_h_
+#define __blast_h_
+
+/*     $Id: blast.h,v 1.2 2006/02/20 08:29:20 akinjo Exp $      */
+
+/* data structure for PSI-BLAST profile (PSSM) */
+
+/* maximum sequence length */
+#define MAXSEQ 1000
+/* secondary structure */
+#ifndef HALF_WINDOW_S
+#define HALF_WINDOW_S 9
+#endif
+
+/* contact number */
+#ifndef HALF_WINDOW_N
+#define HALF_WINDOW_N 9
+#endif
+
+/* residue-wise contact order */
+#ifndef HALF_WINDOW_O
+#define HALF_WINDOW_O 26
+#endif
+
+#if NI_LEVEL==3
+# define NI_UNITS_S ((2*HALF_WINDOW_S+1)*21 + 40)
+# define NI_UNITS_N ((2*HALF_WINDOW_N+1)*21 + 40)
+# define NI_UNITS_O ((2*HALF_WINDOW_O+1)*21 + 40)
+#elif (NI_LEVEL==1 || NI_LEVEL==2)
+# define NI_UNITS_S ((2*HALF_WINDOW_S+1)*21 + 20)
+# define NI_UNITS_N ((2*HALF_WINDOW_N+1)*21 + 20)
+# define NI_UNITS_O ((2*HALF_WINDOW_O+1)*21 + 20)
+#else
+# define NI_UNITS_S ((2*HALF_WINDOW_S+1)*21)
+# define NI_UNITS_N ((2*HALF_WINDOW_N+1)*21)
+# define NI_UNITS_O ((2*HALF_WINDOW_O+1)*21)
+#endif
+
+#define NO_UNITS_S (3)  
+#define NO_UNITS_N (1)  
+#define NO_UNITS_O (1)  
+
+typedef struct _pssm {
+  int len;
+  char *fname;
+  char seq[MAXSEQ];
+  double prof[MAXSEQ][21];
+  double compo[20]; /* AA composition */
+
+  /* site-dependent composition weighted by seq. sep.*/
+  double wlcompo[MAXSEQ][20]; 
+} pssm_t;
+
+typedef struct _ans {
+  int len;
+  int nh, ne, nc;
+  double ave_cn,sd_cn;
+  double ave_co,sd_co;
+  char ss[MAXSEQ];
+  double svec[MAXSEQ][NO_UNITS_S]; 
+  double nvec[MAXSEQ];
+  double ovec[MAXSEQ];
+} ans_t;
+
+
+#define MAXFILES 720
+
+typedef struct _mydata {
+  int nent;
+  long ndat;
+  pssm_t pssm[MAXFILES];
+  ans_t ans[MAXFILES];
+  char *xxfile[MAXFILES];
+} mydata_t;
+
+extern const char amino1[]; /* one-letter amino acid code */
+
+extern void read_pssm(const char *file, pssm_t *prof);
+extern void read_ans(const char *file, ans_t *ans);
+extern void pssm2iunit(const int window, const int ind, const pssm_t *apssm, 
+                       double iunit[]);
+extern int read_file_list(char list[], mydata_t *adata);
+
+double mymax3(double st[], int *ind);
+extern void secdp(int len, double y[][3], char psec[]);
+extern void secmax(int len, double y[][3], char psec[]);
+#endif /* __blast_h_ */
diff --git a/src/chkaccu.c b/src/chkaccu.c
new file mode 100644 (file)
index 0000000..e19d527
--- /dev/null
@@ -0,0 +1,97 @@
+/*     $Id: chkaccu.c,v 1.2 2006/02/20 08:30:52 akinjo Exp $    */
+
+#ifndef lint
+static char vcid[] = "$Id: chkaccu.c,v 1.2 2006/02/20 08:30:52 akinjo Exp $";
+#endif /* lint */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <string.h>
+#include <math.h>
+#include "blast.h"
+
+
+/* average contact number for each residue type */
+double cnave2[] = {
+  25.430 , /* A */
+  21.038 , /* R */
+  20.093 , /* N */
+  18.594 , /* D */
+  29.647 , /* C */
+  20.206 , /* Q */
+  18.008 , /* E */
+  22.505 , /* G */
+  23.572 , /* H */
+  29.469 , /* I */
+  28.173 , /* L */
+  18.452 , /* K */
+  26.466 , /* M */
+  28.057 , /* F */
+  20.350 , /* P */
+  21.420 , /* S */
+  22.747 , /* T */
+  26.913 , /* W */
+  26.627 , /* Y */
+  28.656 , /* V */
+};
+
+void check_accuracy_cn(pssm_t *apssm, ans_t *aans, double pred[], 
+                      double *cor, double *deva)
+{
+  int i,len;
+  double ave=0.0,sd=0.0;
+  double c=0.0,d=0.0;
+  int ind, be0,be1,nn[2][2];
+  double q2;
+
+  len = aans->len;
+  nn[0][0] = nn[1][1] = nn[1][0] = nn[0][1] = 0;
+  for(i = 0; i < len; i++) {
+    ave += pred[i];
+    ind = strchr(amino1,apssm->seq[i]) - amino1;
+
+    if(ind>=0) {
+      be0 = (cnave2[ind] < aans->nvec[i]*log(len)) ? 0 : 1;
+      be1 = (cnave2[ind] < pred[i]*log(len)) ? 0 : 1;
+      nn[be0][be1]++;
+    }
+  }
+  ave /= (double)len;
+  q2 = 100.0*(nn[0][0] + nn[1][1])/(double)len;
+  fprintf(stderr, "Q2: %15.7f %5d %5d\n", q2, nn[0][0]+nn[1][1], len);
+  fprintf(stderr, "Matthews correlation: %5d %5d %5d %5d (11,00,10,01)\n",
+         nn[1][1],nn[0][0],nn[1][0], nn[0][1]);
+
+  for(i = 0; i < len; i++) {
+    sd += (pred[i]-ave)*(pred[i]-ave);
+    c += (aans->nvec[i]-aans->ave_cn)*(pred[i]-ave);
+    d += (aans->nvec[i] - pred[i])*(aans->nvec[i] - pred[i]);
+  }
+  sd = sqrt(sd/(double)aans->len);
+  *cor = c/(aans->len*sd*aans->sd_cn);
+  *deva = sqrt(d/(double)aans->len)/aans->sd_cn;
+  return;
+}
+
+void check_accuracy_rwco(ans_t *aans, double pred[], double *cor, double *deva)
+{
+  int i;
+  double ave=0.0,sd=0.0;
+  double c=0.0,d=0.0;
+
+  for(i = 0; i < aans->len; i++) {
+    ave += pred[i];
+  }
+  ave /= (double)aans->len;
+
+  for(i = 0; i < aans->len; i++) {
+    sd += (pred[i]-ave)*(pred[i]-ave);
+    c += (aans->ovec[i]-aans->ave_co)*(pred[i]-ave);
+    d += (aans->ovec[i] - pred[i])*(aans->ovec[i] - pred[i]);
+  }
+  sd = sqrt(sd/(double)aans->len);
+  *cor = c/(aans->len*sd*aans->sd_co);
+  *deva = sqrt(d/(double)aans->len)/aans->sd_co;
+  return;
+}
+
diff --git a/src/chkaccu.h b/src/chkaccu.h
new file mode 100644 (file)
index 0000000..24e0163
--- /dev/null
@@ -0,0 +1,18 @@
+#ifndef __chkaccu_h_
+#define __chkaccu_h_
+
+#include "sov.h"
+
+/* $Id: chkaccu.h,v 1.2 2006/02/20 08:48:06 akinjo Exp $ */
+
+extern void check_accuracy_ss(ans_t *aans, char psec[], 
+                             double *q3, double *sov3);
+
+extern void check_accuracy_cn(pssm_t *apssm, ans_t *aans, double pred[], 
+                             double *cor, double *deva);
+
+extern void check_accuracy_rwco(ans_t *aans, double pred[], 
+                               double *cor, double *deva);
+
+extern double cnave2[]; /* average contact number for each residue type */
+#endif /* __chkaccu_h_ */
diff --git a/src/crndump.c b/src/crndump.c
new file mode 100644 (file)
index 0000000..71b0a9c
--- /dev/null
@@ -0,0 +1,61 @@
+/*     $Id: crndump.c,v 1.2 2006/02/20 08:33:09 akinjo Exp $    */
+
+#ifndef lint
+static char vcid[] = "$Id: crndump.c,v 1.2 2006/02/20 08:33:09 akinjo Exp $";
+#endif /* lint */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <math.h>
+#include "blast.h"
+#include "xesn.h"
+#include "eprintf.h"
+
+int main(int argc, char *argv[])
+{
+  int i;
+  pssm_t apssm;
+  FILE *op;
+  char *dump_file;
+
+  double uu[MAXSEQ][NI_ESN];  
+  double xx[MAXSEQ][NDIM];
+  double hx[MAXSEQ][NDIM];
+  double win0[NDIM][NI_ESN], *win0p[NDIM];
+  wmatsp_t w0[NWELEM];
+  int nw0;
+
+  if(argc<5) {
+    eprintf("Usage: train wmat win pssm dump.out\n");
+  }
+
+  fprintf(stderr,"# K1,N,L= %d,%d,%d\n", NI_ESN,NDIM, 1);
+  for(i= 0; i < NDIM; i++) {
+    win0p[i] = &win0[i][0];
+  }
+
+  nw0 = read_wmatsp(argv[1], w0);
+  read_wmat(argv[2], NDIM, NI_ESN, win0p);
+  read_pssm(argv[3], &apssm);
+  dump_file = estrdup(argv[4]);
+
+  for(i=0; i < apssm.len; i++) {
+    pssm2iunit(WINDOW_ESN, i, &apssm, uu[i]);
+  }
+  init_esn_state(apssm.len, win0, uu, hx,xx);
+  get_stationary_state(apssm.len, nw0, w0, hx, xx);
+
+  op = fopen(dump_file,"w");
+  write_xx(dump_file, apssm.len, xx);
+
+#ifdef DEBUG
+  for(i=1; i <= apssm.len; i++) {
+    int j;
+    for(j=0; j< NDIM; j++) {
+      printf(" %15.7e", xx[i][j]);
+    }
+    printf("\n");
+  }
+#endif
+  return 0;
+}
diff --git a/src/eprintf.c b/src/eprintf.c
new file mode 100644 (file)
index 0000000..bdf4da2
--- /dev/null
@@ -0,0 +1,95 @@
+/* Copyright (C) 1999 Lucent Technologies */
+/* Excerpted from 'The Practice of Programming' */
+/* by Brian W. Kernighan and Rob Pike */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include "eprintf.h"
+#include <stdarg.h>
+#include <string.h>
+#include <errno.h>
+
+static char *name = NULL;  /* program name for messages */
+
+/* eprintf: print error message and exit */
+void eprintf(char *fmt, ...)
+{
+       va_list args;
+
+       fflush(stdout);
+       if (progname() != NULL)
+               fprintf(stderr, "%s: ", progname());
+
+       va_start(args, fmt);
+       vfprintf(stderr, fmt, args);
+       va_end(args);
+
+       if (fmt[0] != '\0' && fmt[strlen(fmt)-1] == ':')
+               fprintf(stderr, " %s", strerror(errno));
+       fprintf(stderr, "\n");
+       exit(2); /* conventional value for failed execution */
+}
+
+/* weprintf: print warning message */
+void weprintf(char *fmt, ...)
+{
+       va_list args;
+
+       fflush(stdout);
+       fprintf(stderr, "warning: ");
+       if (progname() != NULL)
+               fprintf(stderr, "%s: ", progname());
+       va_start(args, fmt);
+       vfprintf(stderr, fmt, args);
+       va_end(args);
+       if (fmt[0] != '\0' && fmt[strlen(fmt)-1] == ':')
+               fprintf(stderr, " %s\n", strerror(errno));
+       else
+               fprintf(stderr, "\n");
+}
+
+/* emalloc: malloc and report if error */
+void *emalloc(size_t n)
+{
+       void *p;
+
+       p = malloc(n);
+       if (p == NULL)
+               eprintf("malloc of %u bytes failed:", n);
+       return p;
+}
+
+/* erealloc: realloc and report if error */
+void *erealloc(void *vp, size_t n)
+{
+       void *p;
+
+       p = realloc(vp, n);
+       if (p == NULL)
+               eprintf("realloc of %u bytes failed:", n);
+       return p;
+}
+
+/* estrdup: duplicate a string, report if error */
+char *estrdup(char *s)
+{
+       char *t;
+
+       t = (char *) malloc(strlen(s)+1);
+       if (t == NULL)
+               eprintf("estrdup(\"%.20s\") failed:", s);
+       strcpy(t, s);
+       return t;
+}
+
+/* progname: return stored name of program */
+char *progname(void)
+{
+       return name;
+}
+
+/* setmyprogname: set stored name of program */
+void setmyprogname(char *str)
+{
+       name = estrdup(str);
+}
diff --git a/src/eprintf.h b/src/eprintf.h
new file mode 100644 (file)
index 0000000..5052d4c
--- /dev/null
@@ -0,0 +1,14 @@
+/* Copyright (C) 1999 Lucent Technologies */
+/* Excerpted from 'The Practice of Programming' */
+/* by Brian W. Kernighan and Rob Pike */
+
+/* eprintf.h: error wrapper functions */
+extern void    eprintf(char *, ...);
+extern void    weprintf(char *, ...);
+extern char    *estrdup(char *);
+extern void    *emalloc(size_t);
+extern void    *erealloc(void *, size_t);
+extern char    *progname(void);
+extern void    setmyprogname(char *);
+
+#define        NELEMS(a)       (sizeof(a) / sizeof(a[0]))
diff --git a/src/lpredm.c b/src/lpredm.c
new file mode 100644 (file)
index 0000000..0c9747e
--- /dev/null
@@ -0,0 +1,62 @@
+#include <stdio.h>
+#include <stdlib.h>
+#include <string.h>
+#include <math.h>
+#include "blast.h"
+#include "xesn.h"
+#include "eprintf.h"
+#include "chkaccu.h"
+
+#include "xpredm.h"
+
+/*     $Id: lpredm.c,v 1.2 2006/02/20 08:33:52 akinjo Exp $     */
+
+#ifndef lint
+static char vcid[] = "$Id: lpredm.c,v 1.2 2006/02/20 08:33:52 akinjo Exp $";
+#endif /* lint */
+
+/** Linear prediction. */
+int main(int argc, char *argv[])
+{
+  int i,n;
+  pssm_t apssm;
+  wlist3_t wetl[MAXWFILES];
+  int nwet;
+  char psec[MAXSEQ],scn2[MAXSEQ];
+  double wsec[MAXSEQ][3];
+  double pcn[MAXSEQ], prwco[MAXSEQ];
+
+  double uu[MAXSEQ][NI_ESN];
+
+  if(argc<2) {
+    eprintf("Usage: xpredm pssm\n");
+  }
+
+  read_pssm(argv[1],&apssm);
+  apssm.fname = estrdup(argv[1]);
+
+  nwet = read_wlist3_lin(wetl);
+
+  init_xpredm(&apssm, psec, wsec, pcn, scn2, prwco);
+
+  for(i=0; i < apssm.len; i++) {
+    pssm2iunit(WINDOW_ESN, i, &apssm, uu[i]);
+  }
+
+  for(n=0; n<nwet; n++) {
+    lsspred1(&apssm, wetl[n].fwout_ss, wsec);
+    lcnpred1(&apssm, wetl[n].fwout_cn, pcn);
+    lrwcopred1(&apssm, wetl[n].fwout_rwco, prwco);
+  }
+
+  finalize_xpredm(nwet, &apssm, psec, wsec, pcn, scn2, prwco);
+
+#ifndef GTOP
+  print_result(&apssm, psec, wsec, pcn, scn2, prwco);
+#else
+  print_result_gtop(&apssm, psec, wsec, pcn, scn2, prwco);
+#endif
+
+  free(apssm.fname);
+  return 0;
+}
diff --git a/src/secdp.c b/src/secdp.c
new file mode 100644 (file)
index 0000000..92bdcb3
--- /dev/null
@@ -0,0 +1,99 @@
+#include <stdio.h>
+#include "blast.h"
+
+/*     $Id: secdp.c,v 1.2 2006/02/20 08:35:37 akinjo Exp $      */
+
+#ifndef lint
+static char vcid[] = "$Id: secdp.c,v 1.2 2006/02/20 08:35:37 akinjo Exp $";
+#endif /* lint */
+
+static const double scagap = 1.0;
+static  char *sec = "HEC";
+
+static double gap[3][3] = 
+/* { */
+/*   {       1.0113036 ,      -5.8465444 ,      -1.6370586 , }, */
+/*   {      -4.2604538 ,       1.3119079 ,      -0.9302283 , }, */
+/*   {      -1.6658889 ,      -0.9093533 ,       0.6393491 , }, */
+/* }; */
+{
+  {      -1.1949517 ,      -8.4615910 ,      -3.5438586 , },
+  {      -6.8755005 ,      -1.7119301 ,      -3.2458195 , },
+  {      -3.5726889 ,      -3.2249445 ,      -0.9679954 , },
+};
+
+
+
+double mymax3(double st[], int *ind) {
+  if(st[2] >= st[1] && st[2] >= st[0]) {
+    *ind = 2;
+    return st[2];
+  }
+  else if(st[1] >= st[2] && st[1] >= st[0]) {
+    *ind = 1;
+    return st[1];
+  }
+
+  *ind = 0;
+  return st[0];
+}
+
+void secdp(int len, double y[][3], char psec[])
+{
+  double t[MAXSEQ][3];
+  int bt[MAXSEQ][3];
+  double st[3];
+
+
+  int i,j,ind;
+  double tmax;
+
+  for(i=0; i < len; i++) {
+    for(j=0; j<3; j++) {
+      t[i][j] = 0.0;
+      bt[i][j] = 0;
+    }
+  }
+
+  for(j=0;j<3;j++) t[0][j] = y[0][j];
+
+  for(i = 1; i<len; i++) {
+    for(j=0; j<3; j++) {
+      st[0] = t[i-1][0] + gap[0][j]*scagap;
+      st[1] = t[i-1][1] + gap[1][j]*scagap;
+      st[2] = t[i-1][2] + gap[2][j]*scagap;
+      tmax = mymax3(st, &ind);
+      t[i][j] = tmax + y[i][j];
+      bt[i][j] = ind;
+    }
+  }
+
+/*   for(i=0; i< len; i++) { */
+/*     printf ("%5d : ", i+1); */
+/*     for(j=0; j<3; j++) { */
+/*       printf("%8.3f %5d %8.3f: ", t[i][j],bt[i][j], y[i][j]); */
+/*     } */
+/*     printf("\n"); */
+/*   } */
+
+  tmax = mymax3(t[len-1], &ind);
+  psec[len-1] = sec[ind];
+  for(i=len-1; i> 0; i--) {
+    psec[i-1] = sec[bt[i][ind]];
+    ind = bt[i][ind];
+  }
+
+  return;
+}  
+
+void secmax(int len, double y[][3], char psec[])
+{
+  int i,ind;
+  double tmax;
+
+  for(i=0; i< len; i++) {
+    tmax = mymax3(y[i],&ind);
+    psec[i] = sec[ind];
+  }
+  return;
+}
diff --git a/src/sov.c b/src/sov.c
new file mode 100644 (file)
index 0000000..d30f6ab
--- /dev/null
+++ b/src/sov.c
@@ -0,0 +1,314 @@
+/*-----------------------------------------------------------
+/
+/   Program:      sov.c
+/
+/   Secondary structure prediction accuracy evaluation
+/
+/   SOV (Segment OVerlap) measure 
+/
+/   Copyright by Adam Zemla (11/16/1996)
+/   Email: adamz@llnl.gov  
+/
+/------------------------------------------------------------   
+/
+/   Compile:      cc sov.c -o sov -lm
+/
+/------------------------------------------------------------*/
+/*
+ * modified by Akira Kinjo (2005).
+ */
+#include <stdio.h>
+#include <stdlib.h>
+#include <string.h>
+#include <math.h>
+
+#include "sov.h"
+
+/*     $Id: sov.c,v 1.2 2006/02/20 08:37:17 akinjo Exp $        */
+
+#ifndef lint
+static char vcid[] = "$Id: sov.c,v 1.2 2006/02/20 08:37:17 akinjo Exp $";
+#endif /* lint */
+
+/*-------------------------------------------------------------
+/
+/  default_parameters - default parameters for SOV program
+/
+/------------------------------------------------------------*/
+void sov_default_parameters(sov_t *pdata)
+{
+  pdata->input=0;
+  pdata->order=0;
+  pdata->sov_method=1;
+  pdata->sov_delta=1.0;
+  pdata->sov_delta_s=0.5;
+  pdata->sov_out=0;
+
+  return;
+}
+
+/*-----------------------------------------------------------
+/
+/    sov - evaluate SSp by the Segment OVerlap quantity (SOV)
+/                Input: secondary structure segments
+/
+/------------------------------------------------------------*/
+double evalsov(int n_aa, char sss1[MAXRES], char sss2[MAXRES], sov_t *pdata)
+{
+  int i, k, length1, length2, beg_s1, end_s1, beg_s2, end_s2;
+  int j1, j2, k1, k2, minov, maxov, d, d1, d2, n, multiple;
+  char s1, s2, sse[3];
+  double out; 
+  double s, x;
+
+  sse[0]='#';
+  sse[1]='#';
+  sse[2]='#';
+
+  if(pdata->sov_what==0) {
+    sse[0]='H';
+    sse[1]='E';
+    sse[2]='C';
+  }
+  if(pdata->sov_what==1) {
+    sse[0]='H';
+    sse[1]='H';
+    sse[2]='H';
+  }
+  if(pdata->sov_what==2) {
+    sse[0]='E';
+    sse[1]='E';
+    sse[2]='E';
+  }
+  if(pdata->sov_what==3) {
+    sse[0]='C';
+    sse[1]='C';
+    sse[2]='C';
+  }
+  n=0;
+  for(i=0;i<n_aa;i++) {
+    s1=sss1[i];
+    if(s1==sse[0] || s1==sse[1] || s1==sse[2]) {
+      n++;
+    }
+  }
+  out=0.0;
+  s=0.0;
+  length1=0;
+  length2=0;
+  i=0;
+  while(i<n_aa) {
+    beg_s1=i;
+    s1=sss1[i];
+    while(sss1[i]==s1 && i<n_aa) {
+      i++;
+    }
+    end_s1=i-1;
+    length1=end_s1-beg_s1+1;
+    multiple=0;
+    k=0;
+    while(k<n_aa) {